KEGG   Enterobacter cloacae ECNIH5: ECNIH5_19710Help
Entry
ECNIH5_19710      CDS       T03706                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00061  Fatty acid biosynthesis
ecli00620  Pyruvate metabolism
ecli00640  Propanoate metabolism
ecli01100  Metabolic pathways
ecli01110  Biosynthesis of secondary metabolites
ecli01120  Microbial metabolism in diverse environments
ecli01130  Biosynthesis of antibiotics
ecli01200  Carbon metabolism
ecli01212  Fatty acid metabolism
Module
ecli_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ecli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH5_19710
   00640 Propanoate metabolism
    ECNIH5_19710
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECNIH5_19710
Enzymes [BR:ecli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ECNIH5_19710
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ECNIH5_19710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIX60862
UniProt: A0A094YFF5
LinkDB All DBs
Position
4176276..4177625
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLTDDMDANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QMRIMSDEHFQNGGTNIHYLEKKLGLNEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttatcgccaaccgtggcgagattgcactgcgtattcttcgtgcc
tgtaaagaactgggcatcaagaccgtggccgtgcactcaagcgcggatcgcgatttaaaa
cacgtattgctggcggatgagacggtctgtatcggtccggctccgtccgtaaaaagctat
ctgaacatcccggcgatcatcagcgccgccgaaatcactggcgcggtcgcgattcacccg
ggttatggtttcctctctgagaacgccaactttgctgagcaggttgaacgctctggcttt
atcttcattggcccgaaagccgacaccattcgcctgatgggtgacaaagtgtctgccatc
accgcgatgaaaaaagccggcgtgccaaccgtaccgggctctgacggcccgctgaccgac
gatatggatgctaaccgcgcccatgctaaacgcattggctacccggttatcatcaaggcg
tctggcggcggcggcggtcgcggtatgcgcgttgtacgcagcgatgctgaactggcgcag
tctatctccatgaccaaagcggaagcgaaagcggctttcagcaatgacatggtgtacatg
gaaaaatacctggaaaacccacgccacatcgaaattcaggtgctggctgacggtcagggc
aacgcgatctatctggctgaacgtgactgctccatgcagcgtcgtcaccagaaagtcgtc
gaagaagcgccagcgccgggcattacgccggaactgcgtcgctacatcggtgagcgttgc
gccaaagcgtgtgtcgatatcggctatcgcggggcgggtacctttgagttcctgttcgaa
aacggcgagttctacttcattgagatgaacacccgtattcaggttgaacatccggttacc
gaaatgatcaccggcgttgacctgatcaaagaacagctgcgtatcgcagccggtcagccg
ctgtccatcaaacaggaagaagttgtggttaaaggccatgcggtagagtgccgtatcaac
gccgaagacccgaacaccttcctgccaagcccgggtaaaatcacgcgtttccacgcgccg
ggtggctttggtgtgcgctgggagtcccatatttacgccggttacaccgtaccgccgtac
tatgactcaatgatcggtaagctgatctgctacggcgaaaaccgtgacgtggccattgcc
cgcatgaagaacgcccttcaggagctgatcatcgacgggatcaaaaccaacgtagatctc
cagatgcgcatcatgagcgacgagcacttccagaatggtggtactaacatccactacctg
gagaaaaaacttggtctgaacgagaagtaa

DBGET integrated database retrieval system