KEGG   Enterobacter cloacae ECNIH4: ECNIH4_07330Help
Entry
ECNIH4_07330      CDS       T03486                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00564  Glycerophospholipid metabolism
ecln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECNIH4_07330
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECNIH4_07330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 DAO_C Pyr_redox_2 NAD_binding_8 3HCDH_N Thi4 HI0933_like Pyr_redox Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AIX54077
UniProt: A0A2J0PTY6
LinkDB All DBs
Position
complement(1518457..1520085)
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRYSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDGESARECIAENQILKRIARHCIEPTDGLFITLPEDDLAFQETFITACNAAGIQAEA
MDPARARQLEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGARILTGHEVTGLIRE
GHRVCGVRVFDTQYHEHSELFASVVINAAGIWGQRIAEYADLSVRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSTHVDYSDIDYNRVTAEEVDILLREGEKLAP
VMAQTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAERDGMDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTKPCVTAEQPLPGSRQSTEKTLQKIISLPAPLRGSAIYRHGDRTP
VWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVKSLLDLRRRTRVGMGTCQGELCACRVA
GLLQRFHTTTATQSLDQLSAFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEQHD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcacgatcctcgctacagcgatgtgattatcattggcggtggtgccaccggc
gccggtatcgctcgcgattgcgcccttcgcggattaagcgtcacgcttctggaacgccac
gatattgccacgggcgcgaccgggcgtaaccacggcctgcttcacagcggcgcacgatac
gccgtcactgacggtgagtcggcacgggaatgtattgcggaaaaccagatcctcaagcgt
atcgcccgccactgcattgaaccgaccgatggcctctttatcacccttcccgaagatgac
ctcgcctttcaggaaacctttatcaccgcctgtaacgcagcaggtattcaggcggaggcc
atggatccggcgcgggcacggcagctggaaccgtcggtcaacccggcgcttattggcgca
gtgaaagtcccggatggcaccgtcgatccgttccgcctgaccgccgccaatatgctggat
gcccgggaacatggggcgcgcattctgaccggacatgaagtgaccggacttatccgcgaa
ggccatcgcgtctgcggcgtgcgggtgtttgatacgcaataccacgaacacagcgagctg
tttgcctccgtcgtcattaatgccgcggggatctgggggcagcgcattgcagaatacgct
gacctgtcggtgcgcatgttcccggcgaaaggctcgctgctgatcctcgaccatcgcatc
aataaccatgtgatcaaccgctgccgcaaaccgtctgatgccgatatcctcgtgccgggc
gataccatttcgctgattggtacgacctcaacccacgtcgactacagcgacattgactac
aaccgcgtgaccgccgaagaggtggatatcctgctgcgtgaaggcgagaaactggccccg
gtgatggcccagacgcgtattctgcgtgcctacgcgggcgtgcgtcctcttgtcgccagc
gataacgatccgagcggacgtaacgttagccggggcatcgtgctgctcgaccacgccgaa
cgcgacggcatggacggatttatcaccattacaggcggcaaattaatgacctaccgcctg
atggccgaatgggccaccgatgcagtctgccgcaagctggggaataccaagccgtgcgtg
acggcagaacaaccgctgccaggatcgcgtcagtccaccgaaaaaacgttgcaaaaaatc
atctccctgcccgccccgctgcgcggttccgcgatttaccgccacggggacagaacgccg
gtctggctcggcgaaggtcggctgagccgcagcctggtgtgcgagtgcgaagccgtcacc
gcgggcgaggtgcaatacgcggtggagaacctgacggtcaagagcctgctcgatctccgc
cgtcgcacccgcgtcggcatgggaacctgccagggtgaactgtgcgcctgccgtgtggcg
ggtctgctgcagcgttttcataccacgactgccacccagtcgctcgatcagctcagcgcc
tttttaaacgagcgctggaaaggcattcagcctgtcgcctggggcgatgccctgcgtgag
agcgagtttacccgctgggtctaccaggggctttgcggtcttgagaaggagcaacacgat
gaaatttga

DBGET integrated database retrieval system