KEGG   Enterobacter cloacae ECNIH4: ECNIH4_08550Help
Entry
ECNIH4_08550      CDS       T03486                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00500  Starch and sucrose metabolism
ecln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECNIH4_08550
Enzymes [BR:ecln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECNIH4_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AIX54303
UniProt: A0A2J0PCF9
LinkDB All DBs
Position
complement(1801162..1802649)
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIATKYGDKAQLLEAIEALKSNDIAVLLDVVVNHKMGADEKEPVRVQRV
NEQDRTQIDDEIIECEAWTRYTFPVRAGQYSQFVWDYKCFSGVDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTGCNGFRLDAVKHI
PAWFYKEWIEHVQDVADQPLFIVAEYWSHEVDKLQAYIDQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEDDPGCVVVMSNGDDGEKVICLGENYGDKTWRDFLGNREETVTTAADGEGTFT
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacccaacacttttacaatgttttcactggtattaccctgctggcggtgaattg
tggcgagaagtcacggcgttagcccctaatcttaatgaaatcggcatcaatatgatctgg
cttccccccgcgtataaaggtgcgtccggcgggtattcggttggctatgactcatacgat
ctgttcgatctcggcgaatttgaccagaaaggcagtatcgccacgaaatacggtgacaaa
gcgcagctgctggaggccatagaggcgctgaaaagcaatgatatcgccgtgctgctggac
gtcgtggtgaaccacaagatgggggcagacgagaaagaacctgtccgcgttcagcgcgtg
aacgagcaggaccgcacgcaaattgatgatgagatcattgagtgtgaagcctggacacgc
tacaccttccctgtccgtgccgggcaatattctcaattcgtctgggattacaaatgcttc
agcggcgtggaccatattgaaaacccggatgaagacggcatctttaaaatcgtcaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgagatgggtaacttcgattatctg
atgggcgagaatattgattttcgcaatcacgcggtcaccgaagagatcaaatactgggcc
cgctgggtcatggaacagacgggctgcaacggttttcgtctggatgccgtcaagcatatt
cccgcctggttttataaagagtggattgagcacgtccaggacgtcgctgaccagccgctg
tttattgtggcggaatactggtcccatgaggtggataagctgcaggcctatattgaccag
gtcgacggtaaaaccatgctctttgatgctcccctgcagatgaaattccacgaagcttct
cgtcagggacgggattatgacatgagccagatcttcaccggtacgctggtggaggcggat
ccgttccatgcggtcactctcgtcgctaaccacgacacccaacctttgcaggcgctggaa
gcaccggtagaagcctggtttaaaccgctggcgtatgcgttgatcctgctgcgggaaaac
ggcgtgccgagcgtgttttatccggatctcttcggggcgagctatgacgatacgggtgga
gatggcgagacctaccacatcgacatgccggtcattgagcagcttcatgaactgatcctc
gcccggcagcgttttgcccacggcgtgcagaccctgttttttgaccatcctaactgcatc
gccttcagccgcagcggtacggaagacgatcccggctgtgtggtagtgatgtcgaacggc
gacgacggcgagaaagtgatttgtcttggggaaaattacggcgacaaaacgtggcgtgat
ttcctcggcaatcgcgaagaaacggtcactaccgcggcagatggcgaaggcacctttacc
tgtaatggagggagtgtcagcgtttgggtaatagaagatgcgctgtag

DBGET integrated database retrieval system