KEGG   Enterobacter cloacae ECNIH4: ECNIH4_13850Help
Entry
ECNIH4_13850      CDS       T03486                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00020  Citrate cycle (TCA cycle)
ecln00480  Glutathione metabolism
ecln01100  Metabolic pathways
ecln01110  Biosynthesis of secondary metabolites
ecln01120  Microbial metabolism in diverse environments
ecln01130  Biosynthesis of antibiotics
ecln01200  Carbon metabolism
ecln01210  2-Oxocarboxylic acid metabolism
ecln01230  Biosynthesis of amino acids
Module
ecln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecln_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNIH4_13850
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECNIH4_13850
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ECNIH4_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIX55285
UniProt: A0A144XPU3
LinkDB All DBs
Position
complement(2902890..2904140)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAKEEFGGELIDGGPWQKIKNPNTGKEIIVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaagatcaccctgcaaaacggcaag
attaacgttcctcacaatccgattatcccgttcattgaaggtgacggtatcggtgtagac
gttaccccggcaatgctgaaagtggttgatgccgctgttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatcgactcaagtttatggccag
gacgtctggctgccagcagaaacgctggacctgatccgcgactaccgcgttgctatcaaa
ggcccattgaccaccccagtcggcggcggtatccgctccctgaacgtggcactgcgtcag
gagctggacctgtacgtctgtctgcgtccggtgcgttactatcagggcaccccgagcccg
gttaagcaccctgaactgaccgatatggttatcttccgcgaaaactcagaagacatctac
gcgggcatcgagtggaaagcagactctgcagacgcagaaaaagtgattaaattcctgcgc
gaagagatgggcgtgaagaaaattcgcttccctgaacattgcggtatcggcatcaagcca
tgctccgaagaagggactaaacgtctggtgcgcgcggctatcgaatacgcgatcaccaac
gaccgtgactctgtgactctggttcacaaaggcaacatcatgaagttcaccgaaggtgcc
ttcaaagactggggttaccagttggcgaaagaagagtttggcggtgagctgatcgacggt
ggcccgtggcagaagattaagaacccgaacaccggcaaagagatcatcgttaaagatgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtcctgctgaatacgacgtgattgcc
tgtatgaacctgaacggtgactacatctctgacgccctggcagcacaggttggcggtatc
ggtatcgcccctggtgcaaacatcggtgacgagtgcgctctgttcgaagcgacccacggt
actgctcctaaatatgcaggtcaggacaaagtgaacccaggctctatcatcctgtccgca
gagatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgtgaaaggtatg
gaaggcgcgatcaacgccaaaaccgtaacttacgatttcgaacgtctgatggaaggcgct
aaactgctgaaatgctcagagtttggcgacgcgatcatcgcgaacatgtaa

DBGET integrated database retrieval system