KEGG   Enterobacter cloacae ECNIH4: ECNIH4_16070Help
Entry
ECNIH4_16070      CDS       T03486                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00020  Citrate cycle (TCA cycle)
ecln00190  Oxidative phosphorylation
ecln00650  Butanoate metabolism
ecln01100  Metabolic pathways
ecln01110  Biosynthesis of secondary metabolites
ecln01120  Microbial metabolism in diverse environments
ecln01130  Biosynthesis of antibiotics
ecln01200  Carbon metabolism
Module
ecln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecln_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNIH4_16070 (sdhB)
   00650 Butanoate metabolism
    ECNIH4_16070 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECNIH4_16070 (sdhB)
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECNIH4_16070 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ECNIH4_16070 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AIX55695
UniProt: A0A443XW01
LinkDB All DBs
Position
complement(3371379..3372095)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALQRPGQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETESRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattctcagtttatcgttataacccggatgttgatgatgctccgcgtatg
caggactacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgttaatc
cagctgaaagaaaaagatccgacactgtcgttccgtcgctcctgccgtgaaggggtctgc
ggctctgatggcgtgaacatgaacggcaaaaatggcctggcctgcatcacgccaatttcc
gcgttgcagcgtcctggtcagaaaattgttatccgtcctctgccaggcctgccggtcgtg
cgtgatttggtggtagacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccacccgctcgcgagcacttacagtctcctgagcagcgt
gaaaaactcgatgggttgtacgagtgtattctctgcgcatgttgttcaacgtcctgtccg
tcgttctggtggaacccggacaagtttatcggcccggccggtctgctggctgcctatcgc
ttcctgatcgatagccgcgacaccgaaaccgagagtcgtctggaaggactgagtgatgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagtgtatgtccgaagggactg
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagtgcgtaa

DBGET integrated database retrieval system