KEGG   Enterobacter cloacae ECNIH4: ECNIH4_16075Help
Entry
ECNIH4_16075      CDS       T03486                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00020  Citrate cycle (TCA cycle)
ecln00190  Oxidative phosphorylation
ecln00650  Butanoate metabolism
ecln01100  Metabolic pathways
ecln01110  Biosynthesis of secondary metabolites
ecln01120  Microbial metabolism in diverse environments
ecln01130  Biosynthesis of antibiotics
ecln01200  Carbon metabolism
Module
ecln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecln_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNIH4_16075 (sdhA)
   00650 Butanoate metabolism
    ECNIH4_16075 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECNIH4_16075 (sdhA)
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECNIH4_16075 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECNIH4_16075 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AIX55696
UniProt: A0A0P8LGS4
LinkDB All DBs
Position
complement(3372111..3373877)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGALRDATDDEIDASLERLNRWNGNRNGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAFATAMSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggtggcgcaggtatg
cgtgccgcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtattc
ccgacccgttcccacacagtatccgcgcagggcggtattaccgttgcgctgggtaactcc
catgaagataactgggaatggcacatgtacgacacggtaaaaggttccgactacatcggc
gaccaggatgccatcgaatatatgtgtaagaccggcccggaagcgattctggagctggac
cacatggggctgccgttctcccgtctggaaaacggcaccatctatcagcgtccgtttggc
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtaccgcagcggcggctgaccgt
accggccacgcactgctgcacaccctgtatcagcagaacctgaaaaaccacaccaccatc
ttctccgagtggtatgcgctggatctggtgaaaaatgccgatggcgcagtggtcggttgt
accgcgctgtgtatcgaaaccggtgaagtcgtttacttcaaagcccgcgcaaccgtgctg
gccaccggcggtgcaggccgtatttaccagtccaccaccaacgcccacatcaacaccggt
gacggtgtcggcatggcaatccgcgcaggcgtgccggttcaggatatggaaatgtggcag
ttccacccaaccggtatcgccggtgccggcgttctggtaacagaaggctgccgtggtgaa
ggcggctacctgctgaacaaacacggcgaacgcttcatggagcgttatgccccgaatgcg
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgatggcccatggggtccacacgcgaagctgaaactcgaccatctgggtaaa
gaggtgctggaatcccgtctgccgggcattctggagctgtctcgtaccttcgcacacgtc
gacccggtgaaagagccaattcctgttatcccaacctgccactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgttgaccgtgaacgagcagggcgaagatgtggttatt
cctggcctgttcgccgtaggtgaaattgcctgcgtatccgttcacggcgcaaaccgtctc
ggcggcaactcgctgctggacctggtggtattcggccgtgcagtcggtctgcatctgcag
gaatccattgccgagcagggcgcgctgcgtgacgcgaccgacgacgaaattgatgcctct
cttgagcgcctcaaccgctggaacggcaaccgtaacggcgaagatccggtggaaatccgt
aaagcactacaggaatgcatgcagcataacttctcggtattccgcgaaggtgacgcaatg
gccaaaggtcttgagcagctgaaagcgatccgcgagcgtctgaaaaatgcccgtctggat
gacacctccagcgagttcaacacccagcgcgttgaatgcctggagctggataacctgatg
gaaaccgcattcgcgaccgcgatgtcggcaaacttccgtaccgagagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgacgaaaactggctgtgccattccctgtatctg
ccagagtcggaatccatgacgcgtcgtagcgtcaacatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system