KEGG   Enterobacter cloacae ECNIH4: ECNIH4_16480Help
Entry
ECNIH4_16480      CDS       T03486                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecln  Enterobacter cloacae ECNIH4
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECNIH4_16480
Enzymes [BR:ecln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECNIH4_16480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO Glutaredoxin K_oxygenase FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIX55764
LinkDB All DBs
Position
complement(3452916..3454481)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRISGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgaatatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgcgaaatcggcagagattaaggaactgctg
gcagagatcgctgaactgtcaccgaaagtgaccttcaaagaagacaatacgcttgctgtc
cgtaagccttctttcctgatcgccaacccgggctctgatcaggggccgcgctttgccggc
tctccgctggggcatgaatttacctcactggtgctggcgctgctgtggaccggtgggcat
ccgtctaaagaagcgcaggctctgctggagcagatccgcgacatcgacggtgatttcgag
tttgaaacctattactcactctcctgtcacaactgcccggacgtggtgcaggcgctgaat
ctgatgtcggtgctgaacccgcgcattaaacacacggcgattgacggcggtacgttccag
aatgagatcaccgagcgtaacgtaatgggcgtgccggcggtctatctgaatggtcaggag
tttggtcagggccgcatgacgctgacggaaattgttgccaaagtggatactggcgcagaa
aaacgcgcagcagaagcgctgaacaaacgtgatgcctacgatgtgctgatcgtcggttcc
ggcccggcgggcgcggcagcggcggtttactccgcgcgtaaagggatccgtaccggtctg
atgggcgaacgctttggtggtcaggtactggataccgtggacatcgaaaactacatttcc
gtgccgaaaaccgaaggccagaaactggctggcgcacttaaagcgcacgtcagcgactat
gacgtggatgtcatcgacagccagagcgccagcaagctggttcctgctgcggtcgaaggc
ggtttacaccagattgaaacggcatccggcgcggtgctgaaagcgcgtagcattatcatt
gccaccggcgcgaaatggcgcaacatgaacgttccgggtgaagatcagtaccgcaccaaa
ggtgtgacctactgcccgcactgtgacggtccgctgtttaaaggtaaacgcgtagcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcggggattgtggaacat
gtgaccctgctggagttcgcgccagagatgaaggccgaccaggttctgcaggataaagtt
cgcagcctgaaaaacgtcgacatcatcctgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaagtgaccggtctggaataccgtgaccgcatcagcggcgacgtacacagcgtt
cagctttcggggattttcgtgcagattggcctgctgccaaacaccacctggctggaaggc
gcgattgagcgcaaccgtatgggcgagatcatcattgatgcgaaatgtgaaaccagcgta
aaaggcgtcttcgccgcaggtgactgtacgaccgtgccgtacaaacagatcatcattgcc
acgggcgaaggtgcgaaagcgtccctgagttcgtttgactatctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system