KEGG   Enterobacter cloacae ECNIH4: ECNIH4_19135Help
Entry
ECNIH4_19135      CDS       T03486                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00471  D-Glutamine and D-glutamate metabolism
ecln00550  Peptidoglycan biosynthesis
ecln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECNIH4_19135
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECNIH4_19135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecln01011]
    ECNIH4_19135
Enzymes [BR:ecln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     ECNIH4_19135
Peptidoglycan biosynthesis and degradation proteins [BR:ecln01011]
 Precursor biosynthesis
  Amino acid ligase
   ECNIH4_19135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C B_solenoid_dext
Motif
Other DBs
NCBI-ProteinID: AIX56235
UniProt: A0A5E3VKI6
LinkDB All DBs
Position
complement(4009040..4010515)
Genome map
AA seq 491 aa AA seqDB search
MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
ASLGATIYFNHRPENVRDASVVVVSSAISSDNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQITTYGFSEDADVRVEEYKQVGAQGHFTLARQDKELLHVTLNAPGRHNALNAAAA
VAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEAVNGKAGTAMLVDDYGHHPTEVD
ATIKAARAGWPEKNLVMIFQPHRYTRTRDLYDDFASVLSQVDTLLMLDVYAAGETPIPGA
DSRSLCRTIRGRGKVDPILVSDPVQVAEILAPVLTGNDLILIQGAGNIGKIARTLAEIKL
KPQTQEDEHHG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaacaactggcaaaactgcgttcaatcgtgcccgagatgcgtcgcgtccgg
cacattcactttgttggcatcggtggtgctggcatgggcggtattgccgaagtgttagct
aacgaaggttatcagatcagcgggtctgacctggcgccaaaccctgttacgcagcaactg
gcgtcgcttggggcgactatctatttcaaccatcgccctgaaaacgtgcgcgatgcaagc
gtggtggtggtatcgagcgctatctcctctgacaacccggaaatcgttgccgcgcatgaa
gcgcgcattccggtgatccgccgtgctgaaatgttggcggaactgatgcgttttcgtcac
ggcatcgcgattgccgggacccacggtaaaaccacgaccactgcgatggtgtccagtatt
tatgccgaagcgggtctcgacccgacgttcgtcaatggcggtctggtcaaagccgcaggc
gtgcacgcgcgtctgggtcacagccgttacctgattgcggaagcagatgagagcgatgcg
tcgttcctgcatctgcagccgatggtggcgattgtcaccaatatcgaagccgaccatatg
gatacctaccagggcgactttgagaatttaaagcagacctttatcaacttcctgcacaac
ctgccgttttatggccgcgcggtgatgtgtgtggatgacccggtcatccgcgaactgctg
ccgcgtgtggggcgtcaaatcaccacttatggcttcagtgaggatgctgacgttcgcgtg
gaagagtacaaacaggttggtgcgcaggggcatttcacgctggcgcgtcaggacaaagag
ctgctgcacgttacgctgaatgcgccagggcgtcataacgccctcaacgccgcagcggcg
gtggcggtggcgacagaagaaggcatcgatgatgaagcgatcctgcgcgccctggaaagc
ttccagggcactggacgtcgtttcgatttcctcggcgaattcccgctggaggcagtaaac
ggtaaagccggcaccgctatgctggtggatgactacggccaccatccaaccgaagtggac
gcgaccatcaaagctgcacgcgctggctggcctgaaaaaaatcttgtcatgatcttccag
ccgcaccgctatacgcgcacccgcgatctgtatgacgatttcgccagcgtactgtcgcag
gtggatacgctgctgatgctggatgtttatgcagcgggcgaaactccgattccgggggct
gacagtcgttctttgtgtcgcacgattcgcggacgcggtaaagttgaccctattttggtt
tctgacccggtacaggtggcggaaattctggcaccggtgctgaccggtaacgatctgatt
ctgattcagggtgcgggaaatatcggcaaaatcgcccgtaccttagctgaaatcaaactg
aagccgcaaactcaggaggatgagcatcatggctga

DBGET integrated database retrieval system