KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_13050Help
Entry
ENC_13050         CDS       T02615                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00480  Glutathione metabolism
eclo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ENC_13050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eclo02000]
    ENC_13050
Enzymes [BR:eclo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ENC_13050
Transporters [BR:eclo02000]
 Other transporters
  Pores ion channels [TC:1]
   ENC_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: CBK85114
LinkDB All DBs
Position
1366942..1367547
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKLQYVNDALKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHVAS
YMTRVAERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggcgcctgctctcttgcttcccatattacgcttcgcgag
agcggtaaagatttcacgctggacggcgttgacctgatgaaaaagcgtctggaaaacggg
gatgacttttttgcgattaacccaaaaggccaggttccggccctgctgctggatgatggc
accctgctgaccgaaggggtggcgattatgcaattcctggcggacaacgtaccggatcgt
cagctccttgcccccaccggcagcattgcgcgttataaaacgctggagtggctgaactat
attgccaccgaactgcacaaaggctttacgcccctgttccgcccggacacgccggaagag
tacaaacctaccgtgcgcgcgctgctggagaaaaagttgcagtacgttaacgacgcgctg
aaagacgaccagtggatctgtggctcgcgtttcaccatcgccgatgcctatctgtttacc
gttctgcgctgggcgcgcgcggttaagctgaacatggaaggattagaccatgtcgcatcg
tatatgacgcgcgtggcggagcgtcctgcggtggcagcggcgctgaaagcggaagggttg
aattaa

DBGET integrated database retrieval system