KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_20740Help
Entry
ENC_20740         CDS       T02615                                 

Definition
(GenBank) peptidoglycan glycosyltransferase/cell elongation-specific peptidoglycan D,D-transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00550  Peptidoglycan biosynthesis
eclo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ENC_20740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ENC_20740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eclo01011]
    ENC_20740
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ENC_20740
Peptidoglycan biosynthesis and degradation proteins [BR:eclo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ENC_20740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CBK85699
LinkDB All DBs
Position
2122155..2124056
Genome map
AA seq 633 aa AA seqDB search
MKLQNSFRDYTAESALFVRRALVAFTGILLLTGVLIANLYNLQIVRYTDYQTRSNENRIK
LVPIAPSRGIIYDRNGTPLALNRTIYQIEMMPEKVDNVQDTLNALRSVVDLTDDDIAAFK
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLDKDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDVYLTLDLKLQQYIETLLAGSRAAVIVTDPRTGGILAMVSMPSYDPNLFVDG
ISSKDYSGLLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTSLFDPGWWQL
PGSEKRYRDWKKWGHGHLNVTKSLEESADTFFYQVAYDMGIDRLSEWMSKFGYGHYTGID
LAEERSGNMPTREWKLKRFKKPWYQGDTIPVGIGQGYWTATPLQMNKAMMILINDGVVKV
PHLLQSTVEDGKKVPWIQPHEPPVGDIHSGYWEIAKDGMYGVANRPNGTAHKYFAGAPYK
VAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYDNPQVAVAMILENGGAGPAV
GTIMRQILDHIMLGDNNTELPAENPAAAAAEDQ
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagaattcttttcgcgactatacggctgagtccgcgctgtttgtgcgccgg
gcgctggtcgcctttacggggattttgctgcttaccggcgtgctgatcgccaacctctat
aatctgcaaattgtccgctataccgattaccagacccgctcaaacgaaaaccgtatcaag
ctggtgcccatcgcgcccagccgcggcattatctacgatcgtaacggcacgccgctggcg
cttaatcgcaccatctaccagatagagatgatgcccgagaaagtggataacgtgcaggat
accctgaacgcgctgagaagcgttgtcgacctgactgatgacgatatcgctgcgttcaaa
aaagagcgcgcacgttctcaccgcttcacctccattccggtaaaaaccaacctgacggaa
gtgcaggtcgcccgttttgccgttaaccagtaccgtttccccggtgtggaagtcaaaggc
tataaacgccgctactatccttacggctccgcgctgacgcacgtcattggttacgtctcc
aaaatcaacgataaagacgtcgaacgtcttgataaagacggcaagctggctaactacgcc
gcaacccatgatattggcaagctggggatcgaacgttattacgaagacgtgctgcacggt
cagaccgggtatgaagaggttgaagttaacaaccgtggccgcgtgatccgtcagctgaaa
gaggttcccccgcaggcggggcatgacgtctatctgacgctcgacctgaagctacagcag
tatatcgagacgctgctggcgggtagccgtgctgcggttattgtgaccgacccgcgtacc
ggcggcattctggcgatggtttcgatgccaagctacgatccgaacctgttcgtggatggc
atctccagcaaggattactccggcctgctcaacgatccaaacacgccgctggtgaatcgc
gcgacgcagggggtttatcctccagcttcaacggttaaaccgtatgttgccgtgtctgcg
ctgagcgcgggcgtcatcacccgtaataccagtctgtttgaccccggctggtggcagttg
cctggctctgagaaacgctaccgcgactggaaaaaatggggccacggccatctgaacgtg
accaaatcactggaggagtcggcggataccttcttctatcaggtcgcctacgacatgggt
attgaccgtctgtctgaatggatgagcaaattcggctacgggcattacaccggcatagat
ttggcggaagagcgttccggcaacatgccaacccgcgaatggaagctgaagcgctttaaa
aaaccctggtatcagggtgacaccattccggtagggatcggccagggctactggacggca
acgccgctgcaaatgaacaaggcgatgatgatcctcattaacgatggcgttgtgaaagtg
ccgcacctgctgcaaagcaccgttgaagacggcaaaaaagtgccgtggatacagccgcac
gagccgccggtgggtgacattcattccgggtactgggaaatcgcgaaagacggcatgtac
ggtgtagccaaccgccctaacgggacggcgcacaaatatttcgctggcgcaccgtataag
gtagccgcgaaatcaggtacggctcaggtcttcggtctgaaagcgaatgaaacttataat
gcacataaaattgccgaacgtctgcgtgaccacaagctcatgacggcgtttgccccttat
gataacccgcaggttgcggtggcgatgattcttgagaacggcggcgcaggcccggcggtg
ggtaccatcatgcgtcaaatcctcgaccacatcatgctgggtgacaacaacaccgaactg
ccagctgaaaacccggcagccgctgcggcggaggaccaataa

DBGET integrated database retrieval system