KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_20770Help
Entry
ENC_20770         CDS       T02615                                 

Definition
(GenBank) penicillin-binding protein 6. Serine peptidase. MEROPS family S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00550  Peptidoglycan biosynthesis
eclo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ENC_20770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eclo01002]
    ENC_20770
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eclo01011]
    ENC_20770
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ENC_20770
Peptidases [BR:eclo01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ENC_20770
Peptidoglycan biosynthesis and degradation proteins [BR:eclo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ENC_20770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CBK85702
LinkDB All DBs
Position
2126434..2127645
Genome map
AA seq 403 aa AA seqDB search
MKTTFSARFVQRMALTTALCAAAFSAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADARRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVSALGLKNSHFQTVH
GLDAEGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQTNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGRETESKKLLTWGFRFFETVNPLKA
GKEFASEPVWFGDNDRASLGVDKDLYLTIPRGRMKDLKASYVLNTTELHAPLQKNQVVGT
INFQLDGKTIDQRPLVVLEEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactttttctgctcgttttgtgcagcgcatggcgctgaccacggccctttgc
gctgctgcgttctccgcagctcacgcggacgacctgaacatcaagaccatgatccctggc
gttccgcagatcgacgcggaatcctacatcctgattgattacaactccggcaaagttctg
gcagaacagaacgccgatgcccgccgcgatccggccagcctgaccaaaatgatgaccagc
tatgttatcggccaggccatgaaagcaggcaaattcaaagaaaccgacctggtgaccatc
ggtaacgatgcgtgggcaaccggcaacccggtgttcaaaggttcatcgctgatgttcctg
aagccaggcatgcaggttccggtctctcagcttatccgtggcatcaacttgcagtccggt
aacgacgcctgcgtggccatggccgattttgcagcgggcagccaggacgcgtttgtgggc
ctgatgaacagctacgtctccgccctgggcctgaaaaacagccacttccagaccgttcac
ggcctggacgccgagggtcagtacagctccgcgcgtgacatggcgctgatcggtcaggcg
ctgatccgcgatgtgccaaacgagtactctatctacaaagagaaagagttcaccttcaac
ggcattcgtcagaccaaccgtaacggcctgctgtgggacaacagcctgaacgtcgacggc
atcaaaactggccacaccgataaagctggctataacctggtggcctccgccactgaaggc
cagatgcgtctgatctctgccgtgatgggggggcgtacgtttaaaggccgcgaaacggaa
agcaaaaagctgctgacctggggcttccgcttcttcgaaaccgtgaacccgctgaaagct
ggtaaagaatttgcctctgaacctgtctggtttggcgataacgatcgcgcttccctgggc
gtggacaaagatctctatctgacgatcccacgcggtcgtatgaaagatctgaaagccagc
tacgtgctgaataccaccgagctgcacgccccgctgcaaaagaatcaggtcgtgggtacg
attaacttccagctggatggcaaaaccatcgatcagcgcccgctggtggtgctggaggaa
attcctgaaggcaatttcttcggcaaaatcattgattacattaagctgatgttccatcac
tggtttggttaa

DBGET integrated database retrieval system