KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_21110Help
Entry
ENC_21110         CDS       T02615                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Brite
KEGG Orthology (KO) [BR:eclo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ENC_21110
Enzymes [BR:eclo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ENC_21110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_3 FAD_oxidored Pyr_redox_2 GIDA FAD_binding_3 Glutaredoxin FAD_binding_2 Thi4 NAD_binding_8 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: CBK85725
LinkDB All DBs
Position
complement(2156436..2157254)
Genome map
AA seq 272 aa AA seqDB search
MLDANMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKALLTEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEARSWPGR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgctaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaagcgctgctg
acagagattgctgagctgtcgccgaaggtgaccttcaaagaagacaacacgctggcagtc
cgtaagccttctttcctgatcgccaacccagggtctgaccaggggccgcgtttcgcgggc
tctccgctggggcacgaatttacgtccctggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcactctcctgccacaactgtccggacgtggtgcaggcgctgaac
ctgatgtcagtcctcaacccacgcattaagcacacggcgattgacggcggtacgttccag
aacgaaatcaccgagcgcaacgtgatgggcgttccggcggtttacctgaatggtcaggag
ttcggccaggggcgtatgaccttgaccgaaatcgtcgccaaagtggataccggcgcagaa
aaacgtgcggcggaagagttgaaccaacgcgatgcgtacgacgtactgattgttggctcc
ggcccggcgggcgcggcggcagcggtctactccgcacgtaaagggatccgtaccggtctg
atgggggagcgtttcggtggtcaggttctggataccgttgacattgaaaactacatttcc
gtgccgaaaaccgaggccagaagctggccggggcgttga

DBGET integrated database retrieval system