Enterobacter roggenkampii 35734: LI67_002065 Help Entry LI67_002065       CDS       T04878                                  Name (GenBank) DNA-binding protein   KO K05787   DNA-binding protein HU-alpha Organism ecls  Enterobacter roggenkampii 35734 Brite KEGG Orthology (KO) [BR:ecls00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ecls03032]     LI67_002065    03036 Chromosome and associated proteins [BR:ecls03036]     LI67_002065    03400 DNA repair and recombination proteins [BR:ecls03400]     LI67_002065 DNA replication proteins [BR:ecls03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LI67_002065 Chromosome and associated proteins [BR:ecls03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LI67_002065 DNA repair and recombination proteins [BR:ecls03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LI67_002065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AKZ71545 UniProt:  A0A0W2HYX2 LinkDB All DBs Position 1:248658..248930 Genome browser AA seq 90 aa AA seqDB search MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG RNPQTGKEIKIAAANVPAFVSGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagactcaactgattgatgtaattgcggacaaggctgatctgtctaaagtgcag gctaaagctgctctggaatctaccctggctgctattactgagtctctgaaagaaggcgat gctgtacaactggttggtttcggtaccttcaaagtgaaccaccgcgctgagcgtactggc cgcaacccgcagaccggtaaagaaatcaaaatcgccgcagctaacgtgccggcatttgtt tctggtaaagcactgaaagacgctgttaagtaa

DBGET integrated database retrieval system