KEGG   Enterobacter cloacae complex sp. 35734: LI67_002310Help
Entry
LI67_002310       CDS       T04878                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00250  Alanine, aspartate and glutamate metabolism
ecls00410  beta-Alanine metabolism
ecls00640  Propanoate metabolism
ecls00650  Butanoate metabolism
ecls01100  Metabolic pathways
ecls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI67_002310
   00650 Butanoate metabolism
    LI67_002310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI67_002310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI67_002310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecls01007]
    LI67_002310
Enzymes [BR:ecls01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI67_002310
Amino acid related enzymes [BR:ecls01007]
 Aminotransferase (transaminase)
  Class III
   LI67_002310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKZ71591
UniProt: A0A1S2A2P6
LinkDB All DBs
Position
1:307040..308305
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VISAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIDGPAKTAFFSTGAEAVENAVKI
ARAFTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNELHGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQTGQPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacaacgaactgaacgaccggcggttacaggcgacgccgcgcggcatcggcgtg
atgtgtaacttctatgccgataaagccgaaaacgccacggtgtgggacgtggaaggcaat
gagtacatcgacttcgccgccgggatcgcggtgctgaataccggccatcgccatcccaaa
gtcatttccgccatcgaaaaacaactccacgcgtttacccacacggcctaccagattgtg
ccgtacgaaggctacgtggcgcttgccgagcgcatcaaccagcgcgtgccgattgacggc
ccggccaaaaccgcgttcttctcgacgggggctgaggcggtcgaaaacgcggtgaaaatt
gcccgcgcctttaccagacgccccggccttatcaccttcggtggcgcgttccacggccgc
acctttatgaccatggcgctgaccggcaaagttgcgccgtacaagctcggctttggacct
ttccccggctcggtgtatcacgcccagtatccgaatgaactgcacggcgtcagcacggcg
gaagcgttgaaaagcctggaacgcatctttaaagcggatattgcccctgaccaggtcgcg
gcgattattctcgaaccggttcagggagagggcggtttcaacatcgccccggctgatttt
atgcaggcgctgcgcgccctgtgcgatacccacggcattttgctgattgccgacgaggtg
caaagcggcttcgcccgcaccggcaagctgttctcgatggaacaccactgcgtgaagccc
gatctgatcaccatggcgaaaagcctggcgggcgggatgccgctctcggcggtgtcgggc
cgtgctgaagtgatggatgcgcccgcgccgggcgggctgggcggtacctacgcaggtaac
ccgctggcgattgcggcggcgcacgccgtgctggacgtgattgacgaagaggatctctgc
acgcgatcggcgcatcttggccatcacctggtggaagtgttgaacaaggcgaaggaacac
tgcccgtatatcgcggatattcgcgcgcagggctcgatggtggcggtggagtttaacgat
ccgcaaacgggtcagccttcgccggaatttacccgccaggtgcaggagcgtgcattgcag
gaaggtctgctgcttctgagctgcggcgtctacggcaacgtcattcgtttcctctatccg
ctgacgattcccgaagtgcagttccgtaaagcgctggacattatctccgcgtcgctgaca
cgttaa

DBGET integrated database retrieval system