KEGG   Enterobacter cloacae complex sp. 35734: LI67_005670Help
Entry
LI67_005670       CDS       T04878                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00730  Thiamine metabolism
ecls00790  Folate biosynthesis
ecls01100  Metabolic pathways
ecls02020  Two-component system
Module
ecls_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LI67_005670
   00790 Folate biosynthesis
    LI67_005670
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI67_005670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecls04147]
    LI67_005670
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecls00537]
    LI67_005670
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LI67_005670
Exosome [BR:ecls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI67_005670
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecls00537]
 Enzymes
  LI67_005670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PT-VENN Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AKZ72234
LinkDB All DBs
Position
1:1039919..1041337
Genome map
AA seq 472 aa AA seqDB search
MKQSALFIALLPLLITPAIYADTTQTSALDNRAAKGDITQPGGARRLSEDQTAAIRASLN
EKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDRQTLLEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPTNALEKGGKGSITEQLLNARPDVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDANSLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRTDSVPTLAAMTDKAIDLLSKSEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAKKDGNTLVIVTADHAHASQIVPPDTKAPGLTQALNTKDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLKR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagagcgcacttttcatcgcattacttcctctgttaattacccctgccatttat
gcagatacgacgcaaaccagcgccctggataatcgtgcggcaaaaggggatatcacccag
cccggcggcgcgcgccgattgtcggaagatcaaaccgccgccattcgcgcttcgcttaat
gaaaaaccggcgaaaaatattattctgctgattggcgatggaatgggtgattccgaaatc
acggcggcgcgaaattatgccgagggggcgggcggcttttttaaaggtatcgacgcatta
ccgctgaccggacaatatacccactacgcgctggataaaaaaaccggtaaaccggattac
gtaacggactctgcggcctcggccacggcgtggtccaccggcgtgaaaacctataatggc
gcgctgggcgtggatattcacgaaaaagatcgtcaaacccttctggagatggcaaaagcg
gcgggcctggcgaccggtaacgtctccaccgctgaacttcaggatgcgacgcctgcggcg
ctggtggcacacgtgacctcgcgtaaatgctacggcccgtcagtgaccagcgaaaaatgc
ccaacgaacgcgctggaaaaaggtggcaaaggctcgattacggaacagctgctgaatgcg
cgtcctgacgtgacgctgggcggcggcgcgaaaaccttcgcggaaaccgcgacggcgggc
gagtggcagggcaaaacgctgcgcgagcaggcgcaggcgcgcggctatcagctggtgagt
gacgcaaattcgctggcggcgataaccgaggcgaaccaggacaagccgctgctggggctg
ttctctgacggcaacatgcccgtgcgctgggaaggtccaaaagcctcatatcacggcaat
atcgataagccagcagtgacctgtacgcctaaccctaaacgcacggacagcgtaccgacg
ctggcggcgatgaccgataaagcgatcgatctgctgagcaagagcgaaaaagggttcttc
ctgcaggttgagggggcgtcgatcgataagcaggatcatgcggcaaatccgtgcggtcag
attggcgaaaccgtcgatctggacgaagcggtgcagaaggcgctcgcgttcgcgaaaaaa
gacggtaacaccctggtgatcgtcactgcggatcacgcgcacgccagccagatcgttccg
ccagataccaaagcccctggcctgacgcaggcgctcaacaccaaagatggcgccgtcatg
gtgatgagctacggcaactctgaagaagagtccatggagcacaccggcacccagctgcgc
attgccgcctacggcccgcacgcggccaatgtggtaggcctgacggatcaaacggatctg
ttctacaccatgaaggcggcgctgggtctgaaaagataa

DBGET integrated database retrieval system