KEGG   Enterobacter cloacae complex sp. 35734: LI67_006900Help
Entry
LI67_006900       CDS       T04878                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI67_006900
Enzymes [BR:ecls01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LI67_006900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C FMO-like DAO LpxI_N
Motif
Other DBs
NCBI-ProteinID: AKZ72475
UniProt: A0A1S2AZ54
LinkDB All DBs
Position
1:1306999..1308564
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNSLNV
RKPSFLITNPGSELGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKREAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASRLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPDMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRIGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacgatgaaaacccagctcaaggcctaccttgagaaactgaccaaaccc
gttgagctgattgccacgctggacgacagcgcgaaatcggcagagatcaaggaactgctg
gcagagatcgctgaactgtcaccaaaagtgaccttcaaagaggataactcgcttaacgtc
cgtaagccgtctttcctgatcactaacccaggctctgagctggggccgcgttttgccggc
tcaccgctggggcacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcgctctcctgccacaactgtcctgacgtggtgcaggcgctgaac
ctgatgtcggtcctcaacccgcgcatcaaacacacggcaattgatggcggtaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgttccggcggtgtatctgaacggtcaggaa
ttcggccagggccgtatgacgctgacggaaatcgtcgccaaagtggataccggtgccgaa
aaacgtgccgcagaagcgctgaacaaacgcgaggcttacgacgtgctgattgtcggttcc
ggccctgcgggtgcggcggcggcagtgtactccgcgcgtaaagggatccgtaccggcctg
atgggcgaacgcttcggtggccaggtactggataccgtggacattgaaaactatatctcc
gtgccgaaaaccgaaggccagaagctggccggtgcgctgaaggcgcacgtcagcgattac
gacgtggatgtgatcgacagccagagcgccagcaggctggtacctgctgcggttgagggt
ggtttacaccagattgaaactgcctccggcgcggtgctgaaagcgcgcagcatcatcatt
gccaccggcgcgaaatggcgcaacatgaacgtgccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggtaagcgcgtggcggtg
atcggcggcggaaactccggcgtggaagcggcgatcgacctggcagggattgttgaacac
gtaaccctgctggagttcgcgccagacatgaaggccgaccaggttctgcaggataaagtg
cgcagcctgaaaaacgtcgacatcatactgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaggtcaccggtctggaataccgcgaccgcgtgagcggcgacgtgcacagcgtg
cagctttcagggatcttcgtgcagattggtctgctgccaaataccacctggctggaaggg
gcgattgagcgcaaccgcattggcgaaatcatcatcgatgccaagtgtgaaaccagcgtg
aaaggcgtgtttgcggccggcgactgcaccaccgtgccgtacaaacagattattatcgcc
acgggcgaaggggcgaaggcgtctctgagttcgttcgactacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system