KEGG   Enterobacter cloacae complex sp. 35734: LI67_006980Help
Entry
LI67_006980       CDS       T04878                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00550  Peptidoglycan biosynthesis
ecls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI67_006980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecls01002]
    LI67_006980
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecls01011]
    LI67_006980
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LI67_006980
Peptidases [BR:ecls01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LI67_006980
Peptidoglycan biosynthesis and degradation proteins [BR:ecls01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LI67_006980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AKZ72491
UniProt: A0A1C7ZQ48
LinkDB All DBs
Position
1:complement(1321057..1322268)
Genome map
AA seq 403 aa AA seqDB search
MKTTFSARFVQRMALTTALCAAALSAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADARRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNSHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQTNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGRETESKKLLTWGFRFFETVNPLKA
GKEFASEPVWFGDNDRASLGVDKDLYLTIPRGRMKDLKASYVLNSTELHAPLQKNQVVGT
INFQLDGKTIDQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactttttctgctcgttttgtgcagcgcatggcgctgaccacggccctttgc
gcggctgcgctctctgcagctcacgccgatgacctgaatatcaagaccatgatccctggc
gttccgcaaatcgacgcggaatcctacatcctgatcgattacaactctggcaaagtgctg
gcagaacagaatgccgatgcccgccgtgacccggccagcctgaccaaaatgatgaccagc
tacgttatcggccaggcgatgaaggcaggtaaattcaaagaaacggatctggtcaccatc
ggtaacgatgcgtgggcaaccgggaacccggtctttaagggctcctctctgatgttcctg
aaaccgggtatgcaggttcctgtttcccagctgattcgcggtatcaacctgcagtcgggt
aacgatgcctgcgtagcgatggccgatttcgccgccggtagtcaggatgccttcgtagga
ctgatgaacagctacgtgaacgcgctgggtctgaaaaacagccatttccagaccgtacac
ggcctggacgcagacggtcagtacagctcggcacgtgacatggcgttgattggtcaggcg
ctgatccgcgatgttcctaatgagtactctatctataaagagaaagagttcaccttcaac
ggtatccgtcagaccaaccgtaacggcctgctgtgggataacagcctgaacgttgacggc
atcaaaaccggtcacaccgacaaagcgggctacaacctggtcgcctccgccactgaaggc
cagatgcgtctgatctctgccgtgatgggtggccgcacctttaaaggccgtgaaacagaa
agcaagaagctgctgacctggggcttccgtttcttcgaaaccgtgaatccactgaaagca
ggcaaagagtttgcgtctgaacccgtctggttcggcgacaacgaccgtgcttctctcggc
gttgataaagacctctacctgaccattccgcgcggtcgtatgaaggatctgaaagccagc
tacgtcctgaacagcaccgagctgcacgccccgctgcagaaaaatcaggtcgtgggcaca
atcaacttccagctggatggcaaaacgatcgatcagcgcccgctggtggtcctgcaagaa
attcctgaaggcaatttcttcggcaaaatcattgattatattaaattgatgttccaccac
tggtttggttaa

DBGET integrated database retrieval system