KEGG   Enterobacter cloacae complex sp. 35734: LI67_007440Help
Entry
LI67_007440       CDS       T04878                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00010  Glycolysis / Gluconeogenesis
ecls00260  Glycine, serine and threonine metabolism
ecls00680  Methane metabolism
ecls01100  Metabolic pathways
ecls01110  Biosynthesis of secondary metabolites
ecls01120  Microbial metabolism in diverse environments
ecls01130  Biosynthesis of antibiotics
ecls01200  Carbon metabolism
ecls01230  Biosynthesis of amino acids
Module
ecls_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecls_M00002  Glycolysis, core module involving three-carbon compounds
ecls_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI67_007440 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    LI67_007440 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LI67_007440 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecls04131]
    LI67_007440 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecls04147]
    LI67_007440 (gpmA)
Enzymes [BR:ecls01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LI67_007440 (gpmA)
Membrane trafficking [BR:ecls04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LI67_007440 (gpmA)
Exosome [BR:ecls04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LI67_007440 (gpmA)
  Exosomal proteins of melanoma cells
   LI67_007440 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AKZ72570
LinkDB All DBs
Position
1:complement(1413928..1414680)
Genome map
AA seq 250 aa AA seqDB search
MAITKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctattactaagctggttctggtgcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgacgttgatctgtccgagaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctgaaggaagaaggcttcagctttgattttgcttacacctctgtgctg
aaacgtgccatccataccctgtggaacgtgctggacgaactggaccaggcctggctgccg
gttgagaaatcctggaaactgaacgagcgtcactacggtgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatacggtgacgagcaggttaaacagtggcgtcgcggcttcgcg
gtcaccccaccagagctgaccaaagatgacgagcgctacccgggccacgacccgcgttac
gcgaaactgaccgacgctgagctgccaaccaccgagagcctggcgctgaccatcgaccgc
gttgtgccttactggaacgaaaccattctgccacgtctgaaaagcggcgaacgcgtgatt
atcgccgctcacggtaactccctgcgtgcgctggtgaaatacctggacaacatgggtgaa
gacgaaattctcgaactgaacatcccaactggcgtaccgctggtgtatgagttcgacgaa
aacttcaagccaatcaaacactactacctgggtaacgcggacgaaatcgcagcgaaagcg
gcggccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system