KEGG   Enterobacter cloacae complex sp. 35734: LI67_013190Help
Entry
LI67_013190       CDS       T04878                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00240  Pyrimidine metabolism
ecls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LI67_013190
Enzymes [BR:ecls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LI67_013190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 KdpD
Motif
Other DBs
NCBI-ProteinID: AKZ73637
LinkDB All DBs
Position
1:2589420..2590034
Genome map
AA seq 204 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LFNPKTDLFEDIRTEHAAQPIHCVLVDESQFLTREQVHALSEVVDELDIPVLCYGLRTDF
RGELFEGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGKPYADGEQVVIGGNERYVS
VCRKHYKEALSVGSLTAIQHDNRK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactattcggcaatgaatgccgggaaatccaccgcgctgctg
caatcctcgtacaattaccaggagcgagggatgcgtaccgttgtttatacggcggaaatt
gacgatcgctttggcgcggggaaggtgagctccagaatagggctctcgtcgcctgcaaga
ctgtttaacccgaaaaccgatctgtttgaagacattcgtacagaacatgctgcgcagccc
attcattgtgtcctggtcgatgagagccagtttctgacgcgtgaacaggtccatgccctg
tcagaggtagtcgatgagcttgatatccccgtgctgtgttatggcctgcgcacggatttc
cgcggcgagctttttgaggggagccagtatttgctcgcctggtcggataaacttgtcgaa
ctgaaaacgatctgcttctgcggtcgtaaagccagtatggtacttcgtcttgaccaggcc
gggaaaccttatgcagatggtgagcaggtggtgataggcggcaatgaacgttatgtttcg
gtctgccgtaagcattataaagaagcgctgtctgtaggctcgctgacggcgattcagcac
gacaacagaaaataa

DBGET integrated database retrieval system