KEGG   Enterobacter cloacae complex sp. 35734: LI67_018235Help
Entry
LI67_018235       CDS       T04878                                 

Gene name
pheA
Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecls01100  Metabolic pathways
ecls01110  Biosynthesis of secondary metabolites
ecls01130  Biosynthesis of antibiotics
ecls01230  Biosynthesis of amino acids
Module
ecls_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
ecls_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LI67_018235 (pheA)
Enzymes [BR:ecls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     LI67_018235 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     LI67_018235 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2
Motif
Other DBs
NCBI-ProteinID: AKZ74603
UniProt: A0A1S2A568
LinkDB All DBs
Position
1:3687960..3689120
Genome map
AA seq 386 aa AA seqDB search
MTPENPLLDLRVKISALDEKLLALLAERRALAVEVGKAKLDSHRPVRDIDRERDLLERLI
QLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKTNPHSARIAFLGPKGSYSHLAA
RQYAARHFEEFIESGCAKFADIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLSL
VGELTIPIDHCVLVSGSTDLDTIETVYSHPQPFQQCSQFLNRYPNWKIEYTESTSAAMEK
VAQANSPNVAALGSEAGGALYGLQVLERNLANQTQNITRFVVLARKAINVSDQVPAKTTL
LMATGQQAGALVEALLVLRNHNLIMTRLESRPIHGNPWEEMFYLDIQANLESASMQKALR
ELGEITRSMKVLGCYPSENVVPVDPI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggaaaacccgttactggatctgcgcgtaaaaatcagcgcgctggatgagaaa
ctgctggcgctgctggccgaacgccgcgccctcgccgttgaagtgggcaaagccaagctg
gactcccatcgtccggtccgtgatatcgaccgcgagcgggatctgctggaacgtctcatt
cagctcggcaaagcgcatcatctcgatgcccactacatcacccggctgttccagctcatc
atcgaagactccgtcctgacccagcaagcgctactccagcagcatctcaataaaaccaat
ccgcactctgcgcgtatcgctttcctcgggccaaagggctcctattctcacctggccgca
cgtcagtatgccgctcgccatttcgaagaatttattgaaagcggctgcgcgaagtttgcc
gacatttttaaccaggtcgagaccggccaggcggattacgccgtggtgccgattgaaaac
accagctccggcgccatcaacgacgtctacgatttgctgcagcacaccagcctgtcgctg
gtcggcgagctgacgatccctatcgatcactgcgtgctggtctccggctcaacggacctg
gacacgatcgaaacggtctacagccacccgcagccgttccagcagtgcagccagttcctg
aaccgctatccgaactggaaaattgagtacaccgaaagcacctcggcggcgatggaaaaa
gtcgcccaggcgaactcccccaacgttgcggcgctgggcagcgaagcgggcggcgcgctg
tatggtttacaggtgctggaacgcaacctggcgaaccagacgcaaaatattacccgcttc
gtggtgctggcccgcaaggcaatcaatgtgtctgaccaggtaccggccaagaccacgctg
ctgatggccaccggccaacaggccggtgcgctggttgaagctctgctggtactgcgtaat
cacaacctgatcatgacccggctggaatcgcgcccaatccacggtaacccgtgggaagag
atgttctaccttgatatccaggccaacctggagtctgcttccatgcagaaagccctgcgc
gagctgggcgagatcacgcgttccatgaaggtgctgggctgttacccgagcgaaaacgtc
gtcccggtcgatccaatctaa

DBGET integrated database retrieval system