KEGG   Enterobacter roggenkampii 35734: LI67_021190
Entry
LI67_021190       CDS       T04878                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecls  Enterobacter roggenkampii 35734
Pathway
ecls00052  Galactose metabolism
ecls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI67_021190
Enzymes [BR:ecls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     LI67_021190
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N Shikimate_DH Methyltransf_25 CoA_binding MTS PrmA
Other DBs
NCBI-ProteinID: AKZ75172
LinkDB
Position
1:4316379..4317422
AA seq 347 aa
MKSVVIHAEGNVRVEERPIPHIQAADDVRVRIACSGLCGSDIPRIFAGGAHYYPITLGHE
FSGHVEACGTEVHDLKAGDPVACVPLLPCFSCPACEKGYFSLCKQYQFVGSRSEGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPITVGLHAFHLASGCEGKNVIIVGAGTIGLLAMQCA
LALGANSVIAIDINDDKLALATTLGATQVFNSRALAADDILNALSDTPFDQLVLETAGTP
QTVTLAIDIAGPRAQVALVGTLHHDLNLPAATFGKILRKELTLLGSWMNYSAPWPGEEWK
TAARLLTEKKLQLKPLIAHTGDSDSFAQAVQGLNGAPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcaacgtgcgcgttgaagaacgtccaatccct
cacattcaggctgcggatgatgtgcgggtgcgtattgcctgctcaggattatgtggctcc
gatattccgcgaatttttgccggaggggcacattattatcccatcaccctcggacatgaa
tttagcggtcatgtcgaagcctgtggtaccgaagtgcacgatctcaaggcaggcgatccg
gttgcctgcgtgccattactgccctgcttttcctgtccggcgtgtgaaaaaggctacttc
tcgctctgcaagcagtatcagtttgtcggatctcgcagcgaaggcggcaatgcggaatat
atcgtggtcaagcgagcaaacctgttccgccttcctgcagagatggcaattgaagatggt
gcatttattgagcccataaccgtagggctacacgcgtttcatcttgcttccggctgcgag
ggtaagaacgtcatcattgtcggcgcaggcactatcggcctgctggcgatgcagtgtgca
ctggcattgggcgccaacagcgttatcgcgatcgatatcaacgacgataagctcgcgctg
gcaacaacgctgggggcaactcaggtgtttaatagccgcgctctggccgcagacgacatc
cttaacgccttgagcgacaccccgtttgatcagttggttcttgagactgctggcacaccg
caaaccgttacgctcgccattgatatcgccgggccgcgggcccaggtcgcgctggtgggt
acgctgcatcatgacctgaacttacctgcggcgacatttggcaagatactgcgtaaggag
ttgacgcttctgggaagctggatgaattattcggccccgtggccgggtgaagaatggaaa
accgcagcccgtctgctcacagagaaaaaactgcagctaaagccccttattgctcatacc
ggcgatagcgacagctttgctcaggccgtgcaaggactaaacggtgcgcctatgcagggc
aaaattatgctgcgctttgcgtag

DBGET integrated database retrieval system