KEGG   Enterobacter cloacae complex sp. 35734: LI67_023290Help
Entry
LI67_023290       CDS       T04878                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00071  Fatty acid degradation
ecls00280  Valine, leucine and isoleucine degradation
ecls00281  Geraniol degradation
ecls00310  Lysine degradation
ecls00362  Benzoate degradation
ecls00380  Tryptophan metabolism
ecls00410  beta-Alanine metabolism
ecls00640  Propanoate metabolism
ecls00650  Butanoate metabolism
ecls00903  Limonene and pinene degradation
ecls00930  Caprolactam degradation
ecls01100  Metabolic pathways
ecls01110  Biosynthesis of secondary metabolites
ecls01120  Microbial metabolism in diverse environments
ecls01130  Biosynthesis of antibiotics
ecls01200  Carbon metabolism
ecls01212  Fatty acid metabolism
Module
ecls_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI67_023290 (fadB)
   00650 Butanoate metabolism
    LI67_023290 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI67_023290 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI67_023290 (fadB)
   00310 Lysine degradation
    LI67_023290 (fadB)
   00380 Tryptophan metabolism
    LI67_023290 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI67_023290 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LI67_023290 (fadB)
   00281 Geraniol degradation
    LI67_023290 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI67_023290 (fadB)
   00930 Caprolactam degradation
    LI67_023290 (fadB)
Enzymes [BR:ecls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LI67_023290 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LI67_023290 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LI67_023290 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     LI67_023290 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKZ75570
UniProt: A0A1S2AA64
LinkDB All DBs
Position
1:4729571..4731760
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQTELKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVSAEQAQK
IGLVDGVVKPEKLVEGALAILRQAINGELDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
MQTAGKHYPAPIAAVKTIEAAARFGRDEALKLENQSFVPLAHTNEARALVGIFLNDQFVK
GKAKQLTKNVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINEKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPVLEYSGFDRVDVVVEAVVENPKVKKAVLAETEDKVRP
GTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDDTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDPAVDGLLADVSQPKRDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSARYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPAVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcaactggctggaagatggcattgccgaactc
gtgttcgatgcccccggctcagtcaataagctcgataccgcgacggtggccagccttggc
caggcgctggatgttctggaaaaacaaactgaattaaaagggctgctgctgcgctcgaac
aaagcggcctttatcgtcggtgccgatatcaccgaattcctttcgctcttcctggtgcct
gaagaacagctgagccagtggctgcactttgccaatagcgtctttaatcgtctggaagat
ctgcctgtcccgaccatttccgccgttaacggctacgcgctgggcggcggctgtgagtgc
gtgctggcgaccgactaccgcctggcgacgccggatctgcgcatcggcctgccggaaacc
aagctgggcattatgccgggctttggcggctccgtccgtatgccgcgcatgctgggcgcc
gacagcgcgctggagatcattgccgcgggtaaagacgtcagcgcagaacaggcgcagaaa
attggcctggtcgacggcgttgtaaaacctgagaagcttgttgaaggcgcactcgccatt
ctgcgtcaggccattaacggcgagctcgactggaaggccaaacgccagccgaagctggag
ccgttaaaactcagcaagattgaagccaccatgagcttcaccatcgccaaaggcatggtg
atgcagacggcgggtaaacactacccggcgccgatcgcggcggtgaaaaccattgaagcg
gctgcccgtttcgggcgcgatgaagcgctgaagctcgaaaatcagagctttgtcccgctg
gcgcacaccaatgaagcgcgcgcgctggtcggtatcttcctgaacgatcagttcgtaaaa
gggaaagccaaacagctgaccaaaaacgttgagacgccaaaacatgcggcggtactcggc
gcgggcattatgggtggcggcatcgcctaccagtctgcctggaaaggcgtgccggtagtg
atgaaagacatcaacgagaaatccctgacgctgggcatgaccgaagcggccaagctgctg
aataaacagctggaacgcggaaaaattgacggactgaagctcgcaggcgtgatctccacc
attcagcccgtgctggaatacagcggtttcgaccgtgtcgacgtggtggtcgaagccgtc
gtcgagaacccgaaagtgaaaaaagcggtgctggcggaaacggaagacaaggttcgcccg
ggtaccgttctggcctctaacacttccaccattccaatcagcgaactggcgagcgtgctg
aagcgtccggaaaacttctgcggtatgcacttcttcaacccggtacaccgtatgccgctg
gtcgaagtgatccgcggggaaaaaacctctgacgacaccatcgctaaagtggtggcatgg
gccagcaagatgggcaaaacgccgatcgtcgttaacgactgcccgggcttcttcgtcaac
cgcgtgctgttcccttacttcgccggttttagccagctgctgcgcgacggcgcggacttc
cgcaaaatcgacaaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggacgttgtgggcattgataccgcccaccacgcccaggcggtgatggcggcaggtttc
ccgcagcgcatgcagaaagactatcgcgacgcgattgacgcgctgttcgacgctaaccgc
ttcggtcagaaaaacggcctgggcttctggcgctataaagaagacagcaaaggcaaaccg
aagaaagaagaagatccggcggtggatggcctgctggccgacgtcagtcagccaaaacgc
gacttcaccgacgatgaaatcatcgcccggatgatgatcccaatgattaacgaagtggtg
cgttgcctcgaagaaggcattatcgccagcccggcagaagccgacatggcgctggtgtat
ggcctcggcttccctccgttccacggcggcgcgttccgctggctggacacgctcggcagc
gcccgctatctcgatatggcccagcagtatcagcacctcggcccgctgtatgaagtgccg
gaagggctgcgtaacaaagcgcgccataacgaaccctactatcccgcagttgagccagcc
cgtccggttggcgagctgaaaacggcttaa

DBGET integrated database retrieval system