KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_06245Help
Entry
LI66_06245        CDS       T03707                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Pathway
eclx00020  Citrate cycle (TCA cycle)
eclx00190  Oxidative phosphorylation
eclx00650  Butanoate metabolism
eclx01100  Metabolic pathways
eclx01110  Biosynthesis of secondary metabolites
eclx01120  Microbial metabolism in diverse environments
eclx01130  Biosynthesis of antibiotics
eclx01200  Carbon metabolism
Module
eclx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eclx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI66_06245 (sdhA)
   00650 Butanoate metabolism
    LI66_06245 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LI66_06245 (sdhA)
Enzymes [BR:eclx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LI66_06245 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     LI66_06245 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AJB80977
UniProt: A0A422XMY4
LinkDB All DBs
Position
1328666..1330432
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGALRDATDDEIDASLERLNRWNGNRNGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAFATAMSANFRTESRGAH
SRFDFPERDDENWLCHSLYLPESETMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgcgggtggcgcaggtatg
cgcgccgcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtattc
ccgacccgttcccacacagtgtctgcgcagggcggtatcaccgttgcgctgggtaattcc
catgaagataactgggaatggcacatgtacgatacggtaaaaggttccgattacatcggt
gaccaggatgccatcgaatatatgtgtaaaaccggcccggaagcgattctggagctggac
cacatgggtctgccgttctcccgtctggaaaatggcaccatctatcagcgtccgtttggc
ggccagtcgaaaaacttcggcggcgagcaggcggcacgtaccgcagcggcggctgaccgt
accggccacgcgctgctgcacacgctatatcagcagaacctgaaaaaccacaccaccatc
ttctccgagtggtatgcgctggatctggtgaaaaacgccgatggcgccgtggtgggttgt
accgccctgtgcatcgaaactggtgaagtggtctacttcaaagcccgcgctacggtgctg
gcgaccggcggtgcaggccgtatttaccagtccaccaccaacgcccacatcaacaccggt
gacggtgtcggtatggctatccgcgcgggcgtgccggtgcaagacatggagatgtggcag
ttccacccaaccggtatcgccggtgcgggcgtactggtgacagaaggctgccgtggtgaa
ggtggctacctgctgaacaaacatggcgagcgcttcatggagcgttatgcgccaaacgcg
aaagacctggcgggccgtgacgtggtggcgcgttccatcatgatcgaaattcgtgaaggc
cgcggctgtgacggcccttggggtccacacgcgaagctgaaactcgaccatctgggtaaa
gaagtgctggaatcccgtctgccgggcattctggagctgtcccgcaccttcgcgcacgtc
gacccggtgaaagagccaattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatc
ccaggcctgttcgcggtaggcgaaatagcctgcgtatccgtgcacggcgcaaaccgtctg
ggcggcaactccctgctggacctggtggtatttggtcgtgcggtggggctgcatctccag
gaatctattgccgagcagggcgcgctgcgtgatgcgaccgacgacgaaatcgatgcctct
cttgagcgcctcaaccgctggaacggcaaccgtaacggcgaagatccggtggaaattcgt
aaagcgctgcaagagtgtatgcagcacaacttctcggtattccgtgaaggcgacgcgatg
gccaaagggcttgagcagctgaaagcgatccgcgagcgtctgaaaaatgcccgtctggac
gacacctccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaaccgcgttcgcgaccgcgatgtcggcaaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggaacgtgatgacgaaaactggctgtgccattccctgtatctg
ccagagtcggaaaccatgacgcgtcgtagcgtcaacatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system