KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_06250Help
Entry
LI66_06250        CDS       T03707                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Pathway
eclx00020  Citrate cycle (TCA cycle)
eclx00190  Oxidative phosphorylation
eclx00650  Butanoate metabolism
eclx01100  Metabolic pathways
eclx01110  Biosynthesis of secondary metabolites
eclx01120  Microbial metabolism in diverse environments
eclx01130  Biosynthesis of antibiotics
eclx01200  Carbon metabolism
Module
eclx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eclx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI66_06250 (sdhB)
   00650 Butanoate metabolism
    LI66_06250 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LI66_06250 (sdhB)
Enzymes [BR:eclx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LI66_06250 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     LI66_06250 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AJB80978
UniProt: A0A422XN57
LinkDB All DBs
Position
1330448..1331164
Genome map
AA seq 238 aa AA seqDB search
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALNRPGQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETENRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattctcagtttatcgttataacccggatgtagacgatgctccgcgtatg
caggattacaccctcgaagcggaagaaggtcgcgacatgatgctgctggatgccttaatc
cagctgaaagagaaagatcctacgctgtcgttccgccgctcctgccgtgaaggggtgtgt
ggttctgacggtgtgaacatgaacggcaaaaatggcctggcctgcatcacgcctatttct
gcgctaaaccgccctggccagaaaattgttatccgtcctctgcctggcctgccggtcgtg
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatccacccgctcgcgagcacttacagtctcctgagcagcgt
gaaaaactcgatgggttgtacgagtgtattctctgtgcatgctgttcaacgtcatgcccg
tcgttctggtggaatccggataaatttatcggccctgcgggtctgctggctgcctatcgc
ttcctgatcgacagccgcgataccgaaaccgagaatcgtctggaagggctaagtgacgct
ttcagcgtattccgctgccatagcatcatgaactgcgtcagtgtgtgtcctaaggggctg
aacccaacgcgcgccatcggccatattaagtcgatgttgttgcagcgcagtgcgtaa

DBGET integrated database retrieval system