KEGG   Enterobacter hormaechei subsp. oharae: LI66_12400Help
Entry
LI66_12400        CDS       T03707                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
eclx  Enterobacter hormaechei subsp. oharae
Pathway
eclx00240  Pyrimidine metabolism
eclx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LI66_12400
Enzymes [BR:eclx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LI66_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AJB84146
LinkDB All DBs
Position
complement(2602917..2603531)
Genome map
AA seq 204 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LFNPETDLLEDIRVEHASKPVHCVLVDESQFLTREQVHALSEVVDELDIPVLCYGLRTDF
RGELFAGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQSGKPYADGEQVVIGGNERYVS
VCRKHYKEALAVGSLTALQGDNRK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactattcggcaatgaatgcagggaaatcgacggcgttactg
caatcctcatacaattatcaggagcgggggatgcgtaccgttgtttataccgccgaaatc
gacgatcgctttggggcagggaaggtaagctcaagaatagggctttcatcgcctgcaagg
ctgtttaaccctgaaacggacctgctggaggacattcgtgtcgagcatgcctctaagcct
gtccattgcgtgctggtagatgaaagccagttcctgacccgtgagcaggtccatgcgctt
tcagaggtcgttgatgagctggatattcccgttctttgctatggattacgtaccgatttt
cgtggggagttatttgccggcagccagtatctgctcgcctggtcggataagctggttgag
ctgaaaacaatctgcttttgtggccgcaaggcaagtatggttcttcgcctggaccagtcg
ggtaaaccctatgctgatggcgagcaggtggtgataggaggcaatgaacgttatgtctcg
gtctgccgcaagcattataaagaggcgctggctgtaggctcgctgacggcgttacagggc
gacaatcgaaaataa

DBGET integrated database retrieval system