KEGG   Enterobacter hormaechei subsp. xiangfangensis: LI66_14050Help
Entry
LI66_14050        CDS       T03707                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eclx  Enterobacter hormaechei subsp. xiangfangensis
Pathway
eclx00500  Starch and sucrose metabolism
eclx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LI66_14050
Enzymes [BR:eclx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LI66_14050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AJB82420
UniProt: A0A0W2IGH3
LinkDB All DBs
Position
2918155..2919642
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPTGGELWREVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAINALKSNQIAVLLDVVVNHKMGADEKEPVRVQRV
DAQDRTQISDEIIECEAWTRYTFPVRAGQYSQFIWDYKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPQPLFIVAEYWSHEVDKLQHYINQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEEHPGCVVVLSNGDDGEKTICLGENYGNKTWRDFLGNREETVTTAADGEGTFF
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacccaacacttttacaatgttttcactggtactaccccaccggcggtgaactg
tggcgagaagtcacggcattagcccccaatctgaacgaaatcggcatcaatatggtctgg
ttaccgccggcctacaaaggggcatccggcggctattccgtcgggtatgactcttatgac
cttttcgacctcggtgagtttgaccagaaaggcagcgtcgccaccaaatacggcgataaa
gcccagttgctggaggccatcaacgccttaaaaagtaaccagattgcggtgcttctggac
gtggtggtcaaccacaaaatgggggccgatgagaaggaacccgtccgcgtgcagcgcgtg
gatgcgcaggatcgcacccaaatcagcgatgagatcatcgaatgcgaagcctggacgcgc
tacacctttcccgttcgggccggccagtattcgcagttcatctgggattacaaatgcttt
agcggtatcgaccacattgaaaaccccaatgaggacggtatcttcaaaatcgtgaacgac
tacactggcgaaggctggaacgatcaggtcgacgacgagatgggcaatttcgattacctg
atgggtgaaaatattgattttcgcaaccacgcggtgacggaggagatcaaatactgggcg
cgctgggtgatggagcaaacccactgcgacggcttccgccttgacgcggtaaaacacatc
ccggcctggttctataaagagtggattgagcacgtccaggaggtggccccgcagccgctg
tttatcgtggcggaatactggtcacacgaagtggataaattgcagcactacatcaatcag
gtggacggcaaaaccatgctgtttgatgcgccactgcaaatgaaatttcacgaagcctca
cgccagggacgcgactacgatatgagccagattttcaccggtacgctggtggaagccgat
ccgttccatgccgtgacgctggttgccaaccacgacacccaacccttgcaggcgctggaa
gccccagttgaagcctggttcaaaccgctggcctacgcgctcatcctgctgcgtgaaaac
ggcgtgccgagcgtgttctacccggatctttttggcgccagctatgacgacaccggcggg
gatggcgagacgtatcacatcgatatgccggtgattgaacaactccacgagcttatcctc
gcccggcagcgttttgcccacggcgtgcagacgctgtttttcgatcatccaaactgcatt
gcgttcagccgcagcgggactgaggagcacccgggctgtgtggtggtgctgtcgaatggt
gatgacggcgagaagacgatctgcctcggggaaaattacggcaataagacctggcgtgat
tttttaggcaaccgcgaggaaaccgtgaccacggcggcggatggcgaagggacgttcttc
tgtaacgggggaagcgtcagcgtctgggtgattgaggacgcgctgtag

DBGET integrated database retrieval system