KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_05080Help
Entry
LI62_05080        CDS       T03708                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Pathway
ecly00473  D-Alanine metabolism
ecly00550  Peptidoglycan biosynthesis
ecly01100  Metabolic pathways
ecly01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LI62_05080
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI62_05080
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LI62_05080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecly01011]
    LI62_05080
Enzymes [BR:ecly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LI62_05080
Peptidoglycan biosynthesis and degradation proteins [BR:ecly01011]
 Precursor biosynthesis
  Amino acid ligase
   LI62_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AJB61458
UniProt: A0A0E1J664
LinkDB All DBs
Position
complement(1012695..1013792)
Genome map
AA seq 365 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVNDASQYLLH
ADDPAHIALNPSDVSVATVPGVEQGQLIDAGNAQALAQIDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFVTLTRANRDKHSFAQIQAQLGL
PLFVKPANQGSSVGVSKATSEAQFNDAVRLAFEFDHKVVVEQGINGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPAALDPDVNDKIRAIAVEAYQALGCCGMAR
VDVFLTPDNEVVINEINTLPGFTNISMYPKLWQASGISYPELITRLIELALERHAADSAL
KSSVN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagcgcgtaggtattgtctttgggggaaaatcggcagagcacgaggtgtca
ttgcaatcggctaaaaatatcgttgatgcgattgataaaagccgttttgacgtggtgctg
ctgggcattgataaacagggccagtggcatgttaacgatgccagccagtatctgttacac
gctgacgatccggcgcacattgcccttaatccttctgatgtcagcgtcgcaacggttcca
ggcgtggaacagggacagcttatcgatgccgggaacgcgcaggcgctggcacagattgac
gtagtattccctatcgttcacggcacgctgggcgaagacggctccctgcaaggcatgttg
cggatggcgaacctgccatttgtcggttccgatgtgctgggctctgccgcctgcatggat
aaagacgtcacaaaacgtctcctgcgcgacgccggtctgaatattgcgccgttcgtgacg
ctcactcgcgccaaccgcgataaacacagcttcgcgcagatccaggcgcaactcggcctg
ccgctgtttgtgaaaccggcgaatcagggctcgtccgtcggcgtcagcaaagccaccagc
gaagcgcagtttaacgatgccgttcgtctggcctttgagtttgaccataaggtggtggtt
gagcagggaattaacggtcgtgaaattgagtgcgccgtactgggcaacgacttcccgcag
gcgagtacctgtggtgaagtggtactgaacagtgacttctattcctacgacaccaaatat
attgacgataaaggtgcccaggttgtggttcccgccgcgctcgatcctgacgttaacgac
aagatccgggcgatcgccgttgaagcttatcaggcgctgggatgctgtgggatggcgcgc
gtcgacgtgtttctgacgccggataacgaggtggtgattaacgaaatcaacactctgccg
ggctttaccaatatcagcatgtacccgaagctgtggcaggccagcgggataagctatccg
gaactgatcacccgcctgattgaactggcactggagcgccacgccgctgacagcgccctg
aaaagttccgttaactaa

DBGET integrated database retrieval system