KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_06700Help
Entry
LI62_06700        CDS       T03708                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI62_06700
Enzymes [BR:ecly01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LI62_06700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJB61768
LinkDB All DBs
Position
1328084..1329649
Genome map
AA seq 521 aa AA seqDB search
MLDANMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKALLTEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLNNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDIHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgctaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaagcgctgctg
acagagattgctgagctgtcgccgaaggtgaccttcaaagaagacaacacgctggcagtc
cgtaagccttctttcctgatcgccaacccagggtctgaccaggggccgcgtttcgcgggc
tctccgctggggcacgaatttacgtccctggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcactctcctgccataactgtccggacgtggtgcaggcgctgaac
ctgatgtcagtcctcaacccacgcattaagcacacggcgattgacggcggtacgttccag
aacgaaatcaccgagcgcaacgtgatgggcgttccggcggtttacctgaatggtcaggag
ttcggccaggggcgtatgaccttgaccgaaatcgtcgccaaagtggataccggcgcagaa
aaacgtgcggcggaagagttgaaccaacgcgatgcgtacgacgtactgattgttggctcc
ggcccggcgggcgcagcggcggcggtgtactccgcacgtaaagggatccgtaccggtctg
atgggcgagcgtttcggtggtcaggttctggataccgttgacattgaaaactacatttcc
gtgccgaaaaccgaaggccagaagctggccggggcgttgaaagcgcacgtcagcgactac
gacgtggatgtcattgatagccagagcgccagcaaactggttccggccgcggtcgagggt
ggtttgcaccagattgaaacggcgtccggcgcggtgctgaaggcgcgcagcgtgatcatt
gccaccggcgcgaaatggcgcaacatgaacgtcccgggcgaagatcagtatcgcaccaaa
ggcgtgacctattgcccgcactgtgacggcccgctgttcaaaggtaaacgcgtagcggtg
atcggcggcggtaactccggcgtggaagcggctatcgatctggcgggaattgttgaacac
gttaccctgctggaattcgccccggagatgaaagcggaccaggtgttgcaggataaggtg
cgtagcctgaataacgtcgatattgtgctcaatgcccagacgacagaagtgaaaggcgac
ggcagcaaagtgaccggtctggaataccgtgaccgcgtgagtggcgatattcacagcgtg
gcgctggcagggatctttgttcagattggcctgctgccaaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgagatcatcattgatgcgaaatgcgaaaccagcgtg
aagggcgtatttgcggcgggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
actggcgaaggtgcgaaagcgtcgctgagctcgtttgattatctgatccgcaccaaaacc
gcataa

DBGET integrated database retrieval system