KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_13415
Entry
LI62_13415        CDS       T03708                                 

Definition
(GenBank) hypothetical protein
  KO
K11208  GST-like protein
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    LI62_13415
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Other DBs
NCBI-ProteinID: AJB63000
LinkDB
Position
complement(2449583..2450200)
AA seq 205 aa
MIKLYGVPGWGSAISEVMLTLADIPYQFVNVDGFDQPGPQRELLLKLNPLCQVPTLELEN
GAIVTETAAIALMVLDRRPDLAPPVGQAERQQFQRLLIWFVANVYPTFTYADYPERWVSD
APEQLKKNCIEYRKSLYLWFDSQLSASPFAFGKQLTLLDVYIAVARTWGPRHEWFATNTP
NITAVADAVCALPELHKVLKANDII
NT seq 618 nt   +upstreamnt  +downstreamnt
atgatcaaactctatggcgtacccggctggggatcggcaatcagtgaagtgatgctgact
ctggcagacatcccgtatcagttcgtcaacgtggacgggtttgaccagcccggcccgcag
cgcgaattgctgttgaaactgaacccgctgtgccaggtgccgacgctggagctggaaaac
ggggcgatcgtgacggaaaccgcggcgatcgccctgatggtgctcgacagacgtcccgac
ctcgcgccgcccgtagggcaggccgagcgccagcagtttcagcgcctgctcatctggttt
gtggcgaacgtctatcccacctttacgtatgcagattacccggaacgctgggtgtctgat
gccccggaacagctgaagaaaaattgcattgagtaccgaaaatcgctctatctgtggttc
gacagccagctcagcgcctcgccgtttgcgtttggcaaacagctgacgctgcttgacgtc
tatattgccgttgcgcgtacctgggggccacgtcatgagtggtttgccactaacacgcct
aatattaccgccgtcgcggatgccgtctgcgcgctgccggaactgcacaaggtgctaaaa
gctaacgatataatctga

DBGET integrated database retrieval system