KEGG   Enterobacter cloacae 34977: LI62_19805Help
Entry
LI62_19805        CDS       T03708                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ecly  Enterobacter cloacae 34977
Pathway
ecly00500  Starch and sucrose metabolism
ecly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LI62_19805
Enzymes [BR:ecly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LI62_19805
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LI62_19805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJB64185
UniProt: A0A0E1JDM9
LinkDB All DBs
Position
3825258..3826883
Genome map
AA seq 541 aa AA seqDB search
MAGWHTRAIIYQIDTALFYDLNGDGCGDIAGITAKLRYIRRMGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGKLNDIIAFIEQARELGMQVIIELLIQHTSDAHPWFQQARRNPQSP
YRDYYLWSDTDDDDTPPMFPGVEKSIWTWDDEAGQYYRHMFYHHEPDLNLASPAVLKEVE
NIIIFWLKLGVSGFRLDAASHLTKQAGRGDEKRGLWILEHLRRLIEQRNPDAILLGEVDV
EVEAYKDYFGQNDRLNLVLNFWLNKYFYVSLAEKSARPLRNAVKKMIVPPDSCCFANWLR
NHDELDLEGIGKKAKQTVIDTFAPDEEMSVYQRGIRRRLAPMLNGDRKRLAFCHAVLFSL
PGVPVMRYGDEIGMGDDLDLEERYAVRTPMQWAGSQGGGFSDADPETFVAPMIDHGPYRY
QKINVADSLLHRNSLLHCIIDIANTRSEFPEIGVAPFRLINIDSDAVLGIYYETDTRSIL
TFVNFSDKPVNFTARGIRHATWTACLADKRYDDALVCGKTVALNLSGYGYRWFWTDRTAL
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctggcatacacgcgccattatttaccagattgataccgccctgttttacgat
cttaacggcgatggctgtggcgacatcgccggaatcaccgcgaagctgcgctacatccgc
cggatgggcgcgacggttatctggatcaccccgttttacctcacgccttttctcgatgaa
ggctatgacgtgagcgaccatttgcaggtcgatccccgcttcggcaagctcaacgatatc
atcgcctttattgaacaggcgcgggagctggggatgcaggtcattattgagctgctgatc
cagcatacctcggatgcgcatccctggtttcagcaggcccgccgcaaccctcagtcaccc
taccgggactattatctctggtccgacacggacgacgacgatacgccgccgatgttcccc
ggcgtggagaagagcatctggacatgggacgatgaggcggggcaatactaccggcatatg
ttttatcaccacgagccggatctcaatctcgcctcccctgcggtgctgaaggaggttgag
aacatcatcatcttctggctaaagctcggggtgtcgggctttcgcctggatgcggcatcg
cacctgacaaaacaggccggacgtggggatgaaaaacgcggcctgtggatcctggagcat
ttgcgccgtcttattgagcagcgtaacccggacgcgatcctgctcggcgaagtcgacgtg
gaggtggaggcctacaaagattattttggtcagaacgaccggctcaacctggtgctgaat
ttctggctcaataagtacttttacgtcagcctggcagagaagagcgcacgaccgctgcgc
aacgcggtgaagaagatgattgtgccgccggactcctgctgcttcgccaactggctgcgc
aatcatgatgagctggatctggaagggataggtaaaaaagcgaagcaaaccgtcatcgat
acctttgcccctgacgaagagatgagtgtgtatcagcgaggtatccgccgccgtctggcg
ccgatgcttaatggcgatcgaaagcggctggccttttgccatgcggtcttgttttcgcta
ccgggcgtaccggtcatgcgctacggggatgagattggtatgggggatgatttggatctt
gaggagcgttacgccgtacgcaccccgatgcagtgggccggatcgcaaggcggcggtttc
tcagatgccgacccggaaacttttgtcgccccgatgattgaccacggcccgtaccgctat
caaaaaatcaacgtggcggattcgctgttgcaccgcaactcactcctgcactgcattatc
gatatcgccaatacgcgctcggagttccctgagatcggcgtcgcgccgtttcgtcttatt
aatatcgacagcgatgcggtactggggatctattacgaaaccgacacgcgcagcattctg
accttcgttaacttcagcgataagcccgttaattttaccgccagagggatccggcatgcg
acctggaccgcctgcctggcggacaaacgttacgacgacgcgctggtgtgcggcaaaacc
gtcgcgcttaacctcagcggctatggctaccgctggttctggaccgatcgtaccgcactg
cgctga

DBGET integrated database retrieval system