KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_22895Help
Entry
LI62_22895        CDS       T03708                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Pathway
ecly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecly01100  Metabolic pathways
ecly01110  Biosynthesis of secondary metabolites
ecly01130  Biosynthesis of antibiotics
ecly01230  Biosynthesis of amino acids
Module
ecly_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LI62_22895 (aroK)
Enzymes [BR:ecly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     LI62_22895 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 APS_kinase TsaE ABC_tran AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA His_biosynth AAA_25 AAA_28 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase AAA_24 IstB_IS21 AAA_14 GTP_EFTU MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AJB64751
LinkDB All DBs
Position
complement(4441747..4442268)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgtcagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagcggatgtgggctgggtcttcgacgtagaaggcgaagaaggtttccgt
gaccgagaagaaaaagtgatcaacgaactcacggaaaaacagggcattgtgctggcaact
ggcggcggctctgtaaaatctcgcgaaacccgcaaccgtctctccgcccgtggcgtagtg
gtctatcttgagacgaccatcgaaaaacagctggcacgcacgcagcgtgataaaaagcgc
ccgttgttgcaggttgaaacaccgccacgtgaagttctggaagctttggccgatgaacgc
aatcctctgtacgaagagattgctgatgtgaccattcgtactgacgatcaaagcgctaaa
gtggttgcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system