KEGG   Enterobacter hormaechei subsp. steigerwaltii: LI62_22930Help
Entry
LI62_22930        CDS       T03708                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ecly  Enterobacter hormaechei subsp. steigerwaltii
Pathway
ecly00550  Peptidoglycan biosynthesis
ecly01100  Metabolic pathways
ecly01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ecly00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI62_22930 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LI62_22930 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecly01003]
    LI62_22930 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecly01011]
    LI62_22930 (mrcA)
Enzymes [BR:ecly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LI62_22930 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LI62_22930 (mrcA)
Glycosyltransferases [BR:ecly01003]
 Polysaccharide
  Bacterial polysaccharide
   LI62_22930 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:ecly01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LI62_22930 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AJB64758
LinkDB All DBs
Position
4445940..4448492
Genome map
AA seq 850 aa AA seqDB search
MKFVKYLLILAVCCILLGAGSIIGLYKYVEPQLPDVATLRDVRLQIPMQVYSADGELMAQ
YGEKRRIPLTLNQIPPVMVKAFIATEDSRFYEHHGVDPVGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPEKTLMRKIKEVFLAIRIEQLLSKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKPIDQLTLSEMATIAGLPKAPSTFNPLYSLDRATARRNVVLSRMLSEGYISQSEY
DKARSDVIDANYHAPEIAFSAPYLTEMVRQEMVSRYGDKAYEDGYRVYTTVTRKVQQAAQ
QAVRNNVMDYDMRHGYRGPSNVLWKVGEGAWDSKKITDSLKALPTYGPLRPAVVTQADPQ
EAVAMMADGTSVSLRMEGVRWARPYRSDTLQGPTPRKVTDVVQTGQQIWVRQVGDAWWLA
QVPDVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASILNDVPISRWDAGAGSDWQPKNSPAQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPLQVARGYSVMANGGFLVDPYFISKIENDQG
GVLFEAKPKIACPECDIPVIYGDTPKSNVLENKDMEDVAISQERQNLAVPQPQLEQANQA
LVAQSGAQEYAPHVISTPLSFLIKSALNTNIFGEPGWQGTGWRAGRDLQRHDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKSAQPAWDAY
MKAVLEGVPEQPLTPPPGVVTVNIDRSTGQLANGGNSRAEYFIEGTQPTTQAVHEVGTEL
IDNGETHELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattgatccttgcagtctgttgcattctgctgggagcaggc
tcgattattggtttgtacaaatatgtcgagccgcaactccctgatgtcgccacgcttcgt
gatgtgcggcttcagatccctatgcaggtctatagcgccgatggtgaactgatggcgcaa
tacggcgagaaacgtcgtatccctctgaccttaaatcaaattccacccgtgatggtgaag
gcttttatcgccaccgaggacagccgtttttacgagcaccacggtgtcgatccggtcggt
attttccgtgcggcaagcgtggcgctgttctccggtcatgcctctcagggggcaagtacc
attacccagcagctggcgcgtaacttcttcctcagcccggaaaagacgctgatgcgtaag
atcaaagaggtgttcctcgcgatccgcattgagcaactgctgagcaaagacgagatcctt
gagctttacctcaacaagatctatctgggctaccgcgcctatggcgtaggggctgcggct
caggtctattttggtaagccgatcgatcagctcacgctgagcgaaatggcgaccattgcc
ggcctgccaaaagcgccatccacgtttaacccgctctactcgctggaccgcgccaccgcg
cgccgtaacgtggtgctgtcgcgtatgttgagcgaaggctatatcagccagtctgagtac
gataaggcgcgcagcgacgttattgacgccaattaccatgcgccggaaattgctttctct
gcaccgtatctcactgaaatggttcgccaggagatggtgagtcgctacggtgataaagcg
tatgaagatggttatcgcgtctataccaccgtgacccgcaaggtgcagcaggctgcccag
caggcggtgcgtaataacgtgatggattacgatatgcgtcacggctatcgcggcccgtcc
aacgtgctgtggaaagtgggtgaaggcgcatgggacagtaaaaaaatcacggattccctg
aaagcgctgccgacctatggcccgctgcgtccagcggtcgtcacccaggccgatccacag
gaagcggtggcgatgatggccgatggcacatccgtttcgctgcgcatggagggtgtccgc
tgggcgcgtccataccggtctgacacccttcaggggcctacgccacgtaaagtgaccgat
gtcgtacaaaccggacaacaaatctgggtgcgtcaggtaggcgatgcctggtggctggcg
caggtgccggacgtaaactctgcgctggtctccatcaatccgcagaacggtgccgtgatg
gcgctggttggcgggttcgatttcaaccagagcaagtttaaccgcgcgacccaggcgctg
cgtcaggttggttcgaacatcaaacccttcctgtataccgcggcgatggataaggggctg
actctcgccagcattctcaacgacgtgccaatttcccgctgggatgccggtgcgggctct
gactggcagccgaagaactctccggcgcaatacgctggtcctatccgtctgcgccagggc
cttggccagtcgaagaacgtggtcatggttcgcgccatgcgtgcgatgggcgtggattat
gcggcagagtatctgcaacgctttggcttcccggcgcaaaacatcgttcatactgaatct
ctggcgctcggctccgcgtcctttacgccgctccaggttgcgcgtggctattcggtgatg
gcgaacggcggcttcctggtcgatccgtatttcatcagcaaaatcgagaacgatcagggc
ggcgtactgtttgaagcgaaaccgaaaattgcctgccctgaatgcgatattccggtgatt
tacggcgacacgccaaaatccaatgtcctggaaaacaaggatatggaagatgtggcgatc
tctcaggaacgtcagaatctggcggtgccgcagcctcagctggaacaggccaatcaggcg
ctggtcgcccagagtggcgcgcaggagtacgccccgcacgtgatcagcacgccgctgtcg
ttcctgattaagagcgcactgaacaccaacatctttggcgaaccgggctggcaaggcacc
ggctggcgagcgggccgcgatttgcagcgccacgacatcggcggcaaaaccgggacaacc
aacagttcaaaagatgcctggttctcaggttatggtcctggcgttgtcacctccgtctgg
attggttttgacgatcaccgccgcgatctggggcgcacgaccgcctctggcgcgattaaa
gatcagatttccggttacgaaggcggtgcgaagagtgcgcaacctgcctgggatgcttac
atgaaagccgttctcgagggcgtaccagagcagccgctaacgcctccgccgggtgtggtg
acggtgaatattgaccgcagcaccggacagctcgcgaatggcggtaacagccgtgccgag
tatttcatcgagggcactcagccaaccacgcaggcagtgcatgaggtgggtacggaattg
attgataacggcgaaacgcacgagctgttctga

DBGET integrated database retrieval system