KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_06300Help
Entry
LI64_06300        CDS       T03709                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI64_06300
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LI64_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Thi4 FAD_binding_3 K_oxygenase Glutaredoxin FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJB70187
LinkDB All DBs
Position
1302032..1303597
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKALLTEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLTNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDIHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgaatatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaagcactgctg
acagagattgctgagctgtcgccgaaagtgacctttaaagaagacaatactctggcagtc
cgtaagccttctttcctgattgccaacccggggtctgaccaggggccgcgtttcgcgggt
tctccgctgggccacgaatttacctccctggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcactctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcagtcctcaacccgcgcattaagcatacggcgattgacggcggtacgttccag
aacgaaatcaccgagcgcaacgtgatgggcgttccggcggtttacctgaatggtcaggag
ttcggtcagggccgtatgacgctgactgaaatcgtcgccaaagtggataccggcgcagaa
aaacgcgcggcagaagagcttaaccaacgcgatgcgtacgatgtgctgattgtcggctcc
ggcccggcgggcgcggcagcggcggtctactccgcacgtaaagggatccgtaccggtctg
atgggcgaacgttttggtggtcaggtactggataccgtggacattgagaactacatttcc
gtgccgaaaactgaaggtcagaaactggccggggcgttgaaagcgcacgtcagcgattac
gacgtggatgtgattgacagccagagcgccagcaaactggttccggcggcggtggaaggt
ggcttacaccagattgaaaccgcttctggcgcggtgctgaaagcgcgcagcgtgatcatt
gccaccggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcaccaaa
ggcgtgacctattgcccgcactgtgacggcccgctgttcaaaggtaaacgcgtggcggtg
atcggcggcggtaactctggcgtggaagcggctatcgatctggcgggaattgttgaacac
gttaccctgctggagttcgccccggagatgaaagcggaccaggtgttgcaggataaagtg
cgtagcctgactaacgtcgacattgtgctcaatgcccagacgacagaagtgaaaggcgac
ggcagcaaagtgaccggtctggaataccgtgaccgcgtgagtggtgatatccacagcgta
gcgctggcggggatctttgtgcagattggcctgctgcctaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgagatcattattgatgcgaaatgcgaaaccagcgtg
aaaggggtatttgcggcgggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
accggcgaaggtgcgaaagcgtcactgagttcgtttgattacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system