KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_06730Help
Entry
LI64_06730        CDS       T03709                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00020  Citrate cycle (TCA cycle)
eclz00190  Oxidative phosphorylation
eclz00650  Butanoate metabolism
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
Module
eclz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eclz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eclz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI64_06730 (sdhA)
   00650 Butanoate metabolism
    LI64_06730 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LI64_06730 (sdhA)
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LI64_06730 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     LI64_06730 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AJB70261
LinkDB All DBs
Position
1387610..1389376
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELDHMGLPFSRLENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAVGLHLQ
ESIAEQGALRDATDDEIDASLERLNRWNGNRNGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAFATAMSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESETMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgcgggtggcgcaggtatg
cgtgccgcactgcaaatttcccagagcggccagacctgtgcgctgctctctaaagttttc
ccgacccgttcccacactgtgtctgcgcagggcggtatcaccgttgcgctgggtaattcc
catgaagataactgggaatggcacatgtacgatacggtaaaaggttccgattacatcggt
gaccaggatgccatcgaatatatgtgtaaaaccggcccggaagcgattctggagctggat
catatgggtctgccgttctcccgtctggaaaatggcactatctatcagcgtccgtttggc
ggccagtcgaagaacttcggcggcgaacaggcggcacgtaccgcggcggcggctgaccgt
accggccacgcgttgctgcacacgctgtatcagcagaacctgaaaaatcacaccaccatc
ttctccgagtggtacgcgctggatctggtgaaaaacgccgatggcgccgtggtggggtgt
accgcactgtgcattgaaaccggtgaagtggtttacttcaaagcccgcgcaaccgtgctg
gcgaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaacaccggt
gacggcgttgggatggcgatccgcgcgggcgtgccggtgcaggatatggagatgtggcag
ttccacccaaccggtatcgccggtgcgggcgtactggtcaccgaaggctgccgcggtgaa
ggtggttacctgctgaacaaacacggcgaacgcttcatggagcgttatgccccgaatgcg
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgacggcccttggggtccacacgcgaagctgaaactcgaccatctgggtaaa
gaagtgctggaatcccgactgccgggcattctggaactgtcccgcaccttcgcccacgtc
gacccggtaaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtgatt
cctggcctgttcgcggtaggcgaaattgcctgcgtatccgttcacggcgcaaaccgtctg
ggcggcaactccctgctggacctggtggtattcggtcgtgcggtggggcttcatctccag
gaatccatcgccgagcagggcgcgctgcgtgatgcgaccgacgacgaaatcgatgcctct
ctggaacgcctcaaccgctggaacggcaaccgtaacggcgaagatccggtggaaattcgc
aaagcgctgcaagagtgtatgcagcacaacttctcggtattccgtgaaggtgacgcgatg
gccaaagggcttgagcagctgaaagcgatccgcgagcgtctgaagaatgcccgtctggac
gacacctccagcgagttcaacacccagcgcgttgagtgtctggagctggataacctgatg
gaaaccgcgtttgcaaccgccatgtcggcaaacttccgtaccgaaagccgtggcgcccat
agccgcttcgacttcccggatcgtgatgacgaaaactggctgtgccattccctgtatctg
ccagagtcggaaaccatgacgcgtcgtagcgttaacatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system