KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_17475Help
Entry
LI64_17475        CDS       T03709                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00030  Pentose phosphate pathway
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
eclz01230  Biosynthesis of amino acids
Module
eclz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eclz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
eclz_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LI64_17475
Enzymes [BR:eclz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LI64_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AJB72234
LinkDB All DBs
Position
complement(3691078..3691737)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNEVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVEILGNFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAV
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcagtaggatgggccgctctccagtacgtacagcca
ggtaccattgtcggtgttggtacggggtcgacggcggcgcactttatcgatgcgctgggc
acgatgaaggggcagatcgagggcgcggtttccagctccgatgcttccacggaaaagctg
aaaagccttggcattaccgttttcgaccttaacgaagtggaccgtctgggcatttacgtt
gatggtgcggatgaaatcaacggccacatgcagatgatcaaaggcggcggcgcggcgctg
acccgtgaaaaaattatcgcttccgtcgcggacaagttcatctgcatcgcggacgcctcc
aagcaggttgagattctgggtaatttcccgctgccggtcgaagtgatcccgatggcgcgc
agcgcggtggctcgacagctggttaagctgggtggccgtccggaataccgtcagggtgtg
gtgaccgataatggcaacgtgatcctcgacgttcacggccttgagatcctcgatgcagtc
gcgctggaaaatgcgatcaatggtattccaggcgtcgttaccgtagggttatttgccaac
cgtggcgcggacgtggcgctgatcggtacggctgacggtgtgaaaaccatcgtaaaatga

DBGET integrated database retrieval system