KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_18870
Entry
LI64_18870        CDS       T03709                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00052  Galactose metabolism
eclz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI64_18870
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     LI64_18870
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N ADH_zinc_N_2 2-Hacid_dh_C MTS TrkA_N Shikimate_DH Methyltransf_31 Methyltransf_25 3HCDH_N ELFV_dehydrog PrmA
Other DBs
NCBI-ProteinID: AJB72483
LinkDB
Position
3983656..3984699
AA seq 347 aa
MKSVVIHAEGSVRVEERPLPFIQAADDVLVRVICSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVEACGTDVADLKVGDGVACVPLLPCFSCPECEKGYYSLCKHYQFVGSRSEGGNAEY
VVVKRANLFRLPETMTIEDGAFIEPITVGLHAFHLASGCEGKNVIIVGAGTIGLLAMQCA
LALGASSVTAIDINDEKLALASRLGATRVFNSRSLSADDIFSALSESRFDQLVLETAGTP
QTVTLAIDIAGPRAQLALVGTLHHDLHLPAATFGKILRKELTLLGSWMNYSAPWPGEEWE
MAARLLADKKLQLAPLVAHSGDSESFAQAVQALNGSPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcagcgtgcgggttgaagaacgcccccttcct
ttcattcaggccgcagatgatgtgctggtacgcgttatctgctccgggttatgtggctcg
gatattccacgaattttcgccaaaggcgcacactactatcccatcacgttaggccatgaa
ttcagcggatacgtcgaagcatgcggcaccgacgtagccgatcttaaggttggtgatggt
gtggcgtgtgttccgctacttccttgtttttcttgccccgaatgtgaaaaaggctactac
tcattatgtaagcattaccagttcgttggttcacgcagtgagggcggcaatgcggaatat
gtggttgttaagcgcgcaaatttgttccgtcttccagagacgatgacgattgaagatggt
gcatttattgagccgattaccgtcgggttacatgcgttccacctggcttcaggttgtgag
gggaaaaatgtcattattgtcggtgctggtaccatcggtctgctggcgatgcagtgcgcg
ctggcgctgggtgccagcagtgtcaccgcgatcgatatcaacgacgaaaagcttgccctg
gcatcccggctgggcgcgacccgggtatttaacagccgttctctgagcgctgatgacatc
ttcagtgcgctcagcgaaagccggtttgatcaactggtactggagactgccggaacccca
caaaccgtcacgcttgccattgatattgccgggccgcgagcccagcttgcactggtagga
acattgcatcatgacctgcatttacccgctgcaactttcggcaaaattctgcgtaaggaa
ttgacgctgctgggaagctggatgaactattccgcgccatggcctggggaagagtgggaa
atggctgcccgtctgctcgcagataaaaaactacagttagctccgcttgtcgcgcacagt
ggcgacagtgaaagctttgctcaggccgtgcaggccctgaacggttcacccatgcagggc
aaaattatgctgcgcttcgcataa

DBGET integrated database retrieval system