KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_20320Help
Entry
LI64_20320        CDS       T03709                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00250  Alanine, aspartate and glutamate metabolism
eclz00410  beta-Alanine metabolism
eclz00640  Propanoate metabolism
eclz00650  Butanoate metabolism
eclz01100  Metabolic pathways
eclz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI64_20320
   00650 Butanoate metabolism
    LI64_20320
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI64_20320
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI64_20320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eclz01007]
    LI64_20320
Enzymes [BR:eclz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI64_20320
Amino acid related enzymes [BR:eclz01007]
 Aminotransferase (transaminase)
  Class III
   LI64_20320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJB72755
LinkDB All DBs
Position
complement(4263252..4264517)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPD
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERLNQRVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQFPNNLHGVTTA
EALKSLDRIFKADIAPDQVAAIIIEPVQGEGGFNVAPADFMQSLRALCDTHGILLIADEV
QTGFARTGKLFSMENHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRAAHLGHHLVEVLNKAKDGCPYIADIRGQGSMVAVEFTD
PQTGQPSPEFTRQVQERALNEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcaacgccgcgcggtatcggcgtc
atgtgtaacttctatgccgataaagccgaaaacgccacggtgtgggacgtggaaggtaac
gagtatattgattttgccgccgggatcgccgtgctgaataccgggcatcgccatcctgac
gttatcgccgccatcgaaaaacagcttcacgcctttacccataccgcttatcaaatcgtc
ccgtatgaaggctatgtggcgcttgccgagcgcctcaaccagcgcgtgccaatagacggc
ccggccaaaaccgccttcttctcaacgggggcagaagcggtcgaaaacgcggttaaaatc
gcccgcgcgtacaccaggcgtcccggccttatcaccttcggcggcgcgttccatggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccctataaactcggcttcggcccg
ttccccggctcggtgtaccacgcgcaattccccaacaacctgcacggcgtcactaccgcc
gaagcgttaaaaagcctggatcgtatcttcaaagccgatatcgcgcccgatcaggtggcg
gcaatcattattgagccggttcagggcgagggcggattcaacgtcgcgcccgctgatttt
atgcagtcgctgcgtgccctgtgcgatacccacgggattttactgattgccgacgaagtg
caaaccggcttcgcccgcaccggcaagctgttctccatggaaaaccactgcgtgaagccg
gacctgatcaccatggcgaaaagtctggcgggcgggatgccgctctcggcggtctctggc
cgggcggaggtgatggacgcccccgccccgggtgggctgggcggcacctacgcgggcaac
ccgctggcgattgctgcggcccatgcggtactggacgtgattgacgaagaagatctctgc
acccgcgcggcgcatctcgggcatcatctggtcgaggtgctgaataaagcgaaggatggc
tgtccgtatatcgccgatatccgtgggcagggctcgatggtggcggtggaatttaccgat
ccgcaaaccgggcagccgtcgccggaatttacccgtcaggttcaggagcgcgcgttgaac
gaagggctgctgcttttgagctgcggcgtttacggcaacgttattcgcttcctctacccg
ctcaccatccccgaagcgcagttccgtaaggcgctggatattatttccgcctcgctgaca
cgataa

DBGET integrated database retrieval system