KEGG   Enterobacter hormaechei subsp. hormaechei: LI64_20915Help
Entry
LI64_20915        CDS       T03709                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eclz  Enterobacter hormaechei subsp. hormaechei
Pathway
eclz00071  Fatty acid degradation
eclz00280  Valine, leucine and isoleucine degradation
eclz00281  Geraniol degradation
eclz00310  Lysine degradation
eclz00362  Benzoate degradation
eclz00380  Tryptophan metabolism
eclz00410  beta-Alanine metabolism
eclz00640  Propanoate metabolism
eclz00650  Butanoate metabolism
eclz00903  Limonene and pinene degradation
eclz00930  Caprolactam degradation
eclz01100  Metabolic pathways
eclz01110  Biosynthesis of secondary metabolites
eclz01120  Microbial metabolism in diverse environments
eclz01130  Biosynthesis of antibiotics
eclz01200  Carbon metabolism
eclz01212  Fatty acid metabolism
Module
eclz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eclz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI64_20915 (fadB)
   00650 Butanoate metabolism
    LI64_20915 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI64_20915 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI64_20915 (fadB)
   00310 Lysine degradation
    LI64_20915 (fadB)
   00380 Tryptophan metabolism
    LI64_20915 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI64_20915 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LI64_20915 (fadB)
   00281 Geraniol degradation
    LI64_20915 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI64_20915 (fadB)
   00930 Caprolactam degradation
    LI64_20915 (fadB)
Enzymes [BR:eclz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LI64_20915 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LI64_20915 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LI64_20915 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     LI64_20915 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJB72861
LinkDB All DBs
Position
4390632..4392821
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYVDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAQK
IGLVDGVVKPEKLVEGAVAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARLGRDEALKLENQSFVPLAHTNEARALVGIFLNDQFVK
GKAKQLTKSVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINEKSLTLGMTEAAKLL
NKQLERGKIDGLKLSGVISTIQPVLEYSGFDRVDVVVEAVVENPKVKKAVLAETEDKVRP
ETVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDGLLADVSQPKRDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSARYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPAVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacgtagactggctggaagatggcattgccgaactg
gtgttcgatgcccccggctcagtgaacaagcttgataccgcgacggtggccagtcttggc
caggcgctggatgtacttgaaaagcaatcagatttgaaagggctgctgctgcgctccaac
aaagcggcctttatcgttggcgcggatatcaccgaattcctgtcgctgttcctggtaccc
gaagaacagctaagccagtggctgcacttcgccaacagcgtctttaatcgtctggaagat
ctgcctgttccaacgatctctgccgtaaatggctatgcgctgggcggcggctgtgagtgc
gtactcgcaaccgattatcgtctggcgacgccggatctgcgcatcggcctgccggaaacc
aaactgggcattatgccgggctttggcggctcggtgcgtatgccacgtatgctgggtgcc
gatagcgcgctggaaatcattgccgcaggtaaagatgtgggagctgaccaggcgcagaaa
attggcctggtggacggcgtcgtcaaacctgagaagcttgttgaaggcgccgtcgccatt
ctgcgtcaggcgattaacggcgatctcgactggaaagccaaacgtcagccgaagctggag
ccgttaaagctcagcaaaattgaagccaccatgagcttcaccatcgccaaaggcatggtg
atgcagacggcgggtaaacactacccggcgccgatcacggcggtgaaaaccattgaagcg
gctgcccgtctgggccgtgatgaagccctgaagctggaaaaccagagctttgttccgctg
gcgcacaccaacgaagcccgcgcgctggttggtatcttcctcaacgatcagttcgtgaag
ggcaaagccaaacagctgaccaaaagcgttgagacgccaaaacacgcggcggtactcggc
gccggtatcatgggtggcggcatcgcttaccagtcggcctggaaaggcgtgccggtggtg
atgaaagacatcaatgagaaatccctgacgctgggcatgaccgaagcggccaagctgctg
aataaacagcttgagcgcggcaaaattgacggtctgaaactctccggcgtgatctcaacc
attcagccagtgctggagtacagcggtttcgaccgtgtggacgtggtggttgaagcagtc
gttgagaacccgaaagtgaaaaaagcggtgctggccgaaaccgaagacaaggtgcgtccg
gaaaccgtgctggcctctaacacctccaccattcctatcagcgaactggcgagcgtactg
aagcgcccggaaaacttctgcgggatgcacttctttaacccggtgcaccgcatgccgctg
gttgaagtcattcgcggggaaaaaacctccgacgaaaccatcgccaaagtggtggcgtgg
gcgagcaagatgggcaaaacaccgatcgttgttaacgactgcccgggcttcttcgttaac
cgcgtgctgttcccgtacttcgctggtttcagccagctgctgcgcgacggtgcagacttc
cgcaaaatcgacaaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggacgttgtcggcatcgatacggcccatcacgcccaggcggtgatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccattgatgcgctgttcgacgccaaccgc
ttcgggcagaaaaacggtctgggcttctggcgctataaagaagacagcaaaggtaaaccg
aagaaagaagaagatgccgcggtggatggcctactggccgacgtcagtcagccgaaacgc
gacttcaccgacgatgagatcatcgcccgcatgatgattccaatgataaacgaagtggtg
cgctgcctcgaagagggcattatcgccagcccggcagaagcggatatggcgctggtgtac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggatacgcttggcagc
gcccgctatctcgatatggctcagcagtaccagcacctcggcccgctttatgaggtgccg
gaaggtctgcgcaacaaagcgcgccataacgaaccctactatcccgcagttgagccagcc
cgtccggttggcgcgctgaaaacggcttaa

DBGET integrated database retrieval system