KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_0736Help
Entry
EcSMS35_0736      CDS       T00672                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00020  Citrate cycle (TCA cycle)
ecm00190  Oxidative phosphorylation
ecm00650  Butanoate metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01200  Carbon metabolism
Module
ecm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EcSMS35_0736 (sdhA)
   00650 Butanoate metabolism
    EcSMS35_0736 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EcSMS35_0736 (sdhA)
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EcSMS35_0736 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     EcSMS35_0736 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ACB17407
UniProt: B1LLF7
LinkDB All DBs
Structure
PDB: 

Position
740732..742498
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggtcagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgataccgtaaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttttcgcgtcttgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgtactgcggcggctgctgaccgt
accggtcacgcactgttgcacaccctttatcagcaaaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtcggttgt
accgcactgtgcatcgaaactggtgaagtggtttacttcaaagctcgcgctaccgtgctg
gcgactggcggggcagggcgtatttatcagtccaccaccaacgcccacattaacactggc
gacggtgtcggcatggctatccgtgcaggcgtaccggtacaggatatggaaatgtggcag
ttccacccgaccggtattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgatcacctgggtaaa
gaagttctcgaatcccgtctgccgggcatcctggagctttcccgtaccttcgctcacgtt
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgaccggtcaggcgctgacggtgaacgagaaaggcgaagatgtggttgtt
ccggggctgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcagcgggtctgcatctgcaa
gagtctatcgccgagcagggcgcactgcgcgatgccagcgagtctgatgtagaagcgtct
ctggatcgcctgaaccgctggaacaacaaccgtaacggtgaagatccggtggcgatccgt
aaagcactgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaaggtcttgagcagttgaaagttatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
cctgagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system