KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_0737Help
Entry
EcSMS35_0737      CDS       T00672                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00020  Citrate cycle (TCA cycle)
ecm00190  Oxidative phosphorylation
ecm00650  Butanoate metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01200  Carbon metabolism
Module
ecm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EcSMS35_0737 (sdhB)
   00650 Butanoate metabolism
    EcSMS35_0737 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EcSMS35_0737 (sdhB)
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EcSMS35_0737 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     EcSMS35_0737 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ACB16983
UniProt: B1LLF8
LinkDB All DBs
Structure
PDB: 

Position
742514..743230
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgcgaaggtgtgtgc
ggttccgacggtctgaacatgaacggtaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggttgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system