KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1417Help
Entry
EcSMS35_1417      CDS       T00672                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2
Motif
Other DBs
NCBI-ProteinID: ACB19962
UniProt: B1LDV7
LinkDB All DBs
Structure
PDB: 

Position
1401480..1402523
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEMPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLTMAEQLGATVVINGAKEDTIARCQQFTEEMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
atgcctgtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatttgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgcca
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagctacggatattgccgtcgttgat
gtgctggaaaaacgtctgacaatggcggaacagctcggcgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagaaatgggcgcagatatt
gttttcgaaacagcaggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtaccgggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system