KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1680Help
Entry
EcSMS35_1680      CDS       T00672                                 

Gene name
gadA
Definition
(GenBank) glutamate decarboxylase GadA
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00250  Alanine, aspartate and glutamate metabolism
ecm00410  beta-Alanine metabolism
ecm00430  Taurine and hypotaurine metabolism
ecm00650  Butanoate metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm02024  Quorum sensing
Module
ecm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    EcSMS35_1680 (gadA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcSMS35_1680 (gadA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcSMS35_1680 (gadA)
   00430 Taurine and hypotaurine metabolism
    EcSMS35_1680 (gadA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    EcSMS35_1680 (gadA)
Enzymes [BR:ecm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EcSMS35_1680 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACB15938
UniProt: B1LFC3
LinkDB All DBs
Structure
PDB: 

Position
1680092..1681492
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgca
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcatttcagattatcaatgacgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccacaagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgcttggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctggtgtgcggt
ccggtgcaaatctgctggcataaattcgcccgctactgggatgtggagttgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aataccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
cagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggcggtcagattgggactttcgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcttcctaccaggttgccgcttatctggcggatgaaatcgccaaactg
ggaccgtatgagtttatctgtaccggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctctacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacatacctga

DBGET integrated database retrieval system