KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_2393Help
Entry
EcSMS35_2393      CDS       T00672                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit, A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00564  Glycerophospholipid metabolism
ecm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EcSMS35_2393 (glpA)
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EcSMS35_2393 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACB17598
UniProt: B1LLJ3
LinkDB All DBs
Position
2441967..2443595
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGEIQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYSEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADTPLPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccgggattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggtagagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctacacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgtattagtgaaaaccagatcctgaaacgc
attgcgcgtcactgcgttgaaccgaccaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttatccgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaatatgcttgat
gccaaagaacacggtgccgttatccttactgctcatgaagtcacggggctgattcgtgaa
ggcgcgacggtgtgcggtgttcgtgtacgtaaccatctcaccggcgaaattcaggcactt
catgcgcctgtcgtagttaatgccgccgggatctgggggcaacacattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaaggatcgctgctgatcatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgcaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctaattggcaccacctctttacgtattgattacagcgagattgacgat
aatcgagtgacggcagaagaagttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgagcctactctggcgtacgcccgctggttgccagc
gatgacgatccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacgggtttatcaccatcaccggtggcaaactgatgacctaccgcctg
atggcggaatgggctactgacgcggtgtgtcgcaagctgggcaacacgcgcccctgtacc
actgccgacacgccgttgcctggctcacaggaaccggcagaagtcacgctgcgcaaagtg
atctccctgcccgctccgctgcgcggttccgcagtttaccggcacggcgatcgcacacca
gcctggctgagcgaaggccgcctgcaccgcagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcagtagaaaatttaaacgttaacagcctgctggatttacgc
cgtcgtacccgtgtagggatgggtacctgccagggcgaactctgcgcctgccgggctgcc
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatagcatggggagacgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system