KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_2821
Entry
EcSMS35_2821      CDS       T00672                                 

Gene name
recX
Definition
(GenBank) regulatory protein RecX
  KO
K03565  regulatory protein
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Brite
KEGG Orthology (KO) [BR:ecm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecm03400]
    EcSMS35_2821 (recX)
DNA repair and recombination proteins [BR:ecm03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EcSMS35_2821 (recX)
SSDB
Motif
Pfam: RecX
Other DBs
NCBI-ProteinID: ACB18090
UniProt: B1LQ16
LinkDB
Structure
PDB: 
3C1D

Position
complement(2897364..2897864)
AA seq 166 aa
MTESTSLRPAYARLLDRAVRILAVRDHSEQELRRKLAAPIMGKNGPEEIDATAEDYERVI
AWCHEHGYLDDSRFVARFIASRSRKGYGPARIRQELNQKGISREATEKAMRECDIDWCAL
ARDQATRKYGEPLPTVFSEKVKIQRFLLYRGYLMEDIQDIWRNFAD
NT seq 501 nt   +upstreamnt  +downstreamnt
atgacagaatcaacatcccttcgcccggcatatgctcgcctgttggatcgtgcggtacgc
attctggcggtgcgcgatcacagtgagcaagaactgcgacgtaaactcgcggcaccgatt
atgggcaaaaatggcccggaagagattgatgccacggcagaagattacgagcgcgttatt
gcctggtgccatgaacatggctatcttgatgacagccgatttgttgcgcgctttatcgcc
agccgtagccgcaaaggttatggacctgcgcgtattcgtcaggaactgaatcagaaaggt
atttcccgcgaagcgacagaaaaagcgatgcgtgaatgtgacatcgactggtgcgcactg
gcgcgcgatcaggcgacgcgaaaatatggcgaacctttgccaactgtcttttcagaaaaa
gttaagatccagcgttttctgctctatcgtggctatctgatggaagatatccaggatatt
tggcgaaattttgccgactga

DBGET integrated database retrieval system