KEGG   Escherichia coli K-12 MG1655: b0084Help
Entry
b0084             CDS       T00007                                 

Gene name
ftsI
Definition
(RefSeq) transpeptidase involved in septal peptidoglycan synthesis; penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00550  Peptidoglycan biosynthesis
eco01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    b0084 (ftsI)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    b0084 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
    b0084 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eco03036]
    b0084 (ftsI)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     b0084 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   b0084 (ftsI)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    b0084 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-GeneID: 944799
NCBI-ProteinID: NP_414626
Pasteur: ftsI
RegulonDB: ECK120000335
ECOCYC: EG10341
ASAP: ABE-0000309
UniProt: P0AD68
LinkDB All DBs
Structure
PDB: 

Position
91413..93179
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcgaaaacgcagaaaccaaaacgtcaggaagaacatgccaactttatc
agttggcgttttgcgttgttatgcggctgtattctcctggcgctggcttttctgctcgga
cgcgtagcgtggttacaagttatctccccggatatgctggtgaaagagggcgacatgcgt
tctcttcgcgttcagcaagtttccacctcccgcggcatgattactgaccgttctggtcgc
ccgttagcggtgagcgtgccggtaaaagcgatttgggctgacccgaaagaagtgcatgac
gctggcggtatcagcgtcggtgaccgctggaaggcgctggctaacgcgctcaatattccg
ctggatcagctttcagcccgcattaacgccaacccgaaagggcgctttatttatctggcg
cgtcaggtgaaccctgacatggcggactacatcaaaaaactgaaactgccggggattcat
ctgcgtgaagagtctcgccgttactatccgtccggcgaagtgactgctcacctcatcggc
tttactaacgtcgatagtcaagggattgagggcgttgagaagagtttcgataaatggctt
accgggcagccgggtgagcgcattgtgcgtaaagaccgctatggtcgcgtaattgaagat
atttcttctactgacagccaggcagcgcacaacctggcgctgagtattgatgaacgcctg
caggcgctggtttatcgcgaactgaacaacgcggtggcctttaacaaggctgaatctggt
agcgccgtgctggtggatgtcaacaccggtgaagtgctggcgatggctaacagcccgtca
tacaaccctaacaatctgagcggcacgccgaaagaggcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggctcaacggttaaaccgatggtggtaatgaccgcgttgcaacgt
ggcgtggtgcgggaaaactcggtactcaataccattccttatcgaattaacggccacgaa
atcaaagacgtggcacgctacagcgaattaaccctgaccggggtattacagaagtcgagt
aacgtcggtgtttccaagctggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttggactgggaaaagcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacggg
ctaatggtaacaccattacagttagcgcgagtctacgcaactatcggcagctacggcatt
tatcgcccactgtcgattaccaaagttgaccccccggttcccggtgaacgtgtcttcccg
gaatccattgtccgcactgtggtgcatatgatggaaagcgtggcgctaccaggcggcggc
ggcgtgaaggcggcgattaaaggctatcgtatcgccattaaaaccggtaccgcgaaaaag
gtcgggccggacggtcgctacatcaataaatatattgcttataccgcaggcgttgcgcct
gcgagtcagccgcgcttcgcgctggttgttgttatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtctttggtgccatcatgggcggcgtattgcgtacc
atgaacatcgagccggatgcgctgacaacgggcgataaaaatgaatttgtgattaatcaa
ggcgaggggacaggtggcagatcgtaa

DBGET integrated database retrieval system