KEGG   Escherichia coli K-12 MG1655: b0485Help
Entry
b0485             CDS       T00007                                 

Gene name
glsA
Definition
(RefSeq) glutaminase 1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco00250  Alanine, aspartate and glutamate metabolism
eco00471  D-Glutamine and D-glutamate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b0485 (glsA)
   00220 Arginine biosynthesis
    b0485 (glsA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    b0485 (glsA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     b0485 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 946187
NCBI-ProteinID: NP_415018
Pasteur: ybaS
RegulonDB: ECK120002869
ASAP: ABE-0001688
UniProt: P77454
LinkDB All DBs
Structure
PDB: 

Position
511641..512573
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtaccaggtcaactg
gcggcagtggctatcgtgacctgcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcactggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggcgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccatagcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtatacccgtcagtgctccacgctcctc
aatactattgaactggcaacgcttggcgcgacgctggcggcaggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggagtgatgggaattgccgcgttctca
ccaccgctggacgaagatggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system