KEGG   Escherichia coli K-12 MG1655: b0724Help
Entry
b0724             CDS       T00007                                 

Gene name
sdhB
Definition
(RefSeq) succinate:quinone oxidoreductase, iron-sulfur cluster binding protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00020  Citrate cycle (TCA cycle)
eco00190  Oxidative phosphorylation
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Module
eco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    b0724 (sdhB)
   00650 Butanoate metabolism
    b0724 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    b0724 (sdhB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     b0724 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     b0724 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-GeneID: 945300
NCBI-ProteinID: NP_415252
Pasteur: sdhB
RegulonDB: ECK120000921
ECOCYC: EG10932
ASAP: ABE-0002468
UniProt: P07014
LinkDB All DBs
Structure
PDB: 

Position
757689..758405
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggatgaaggtcgcgacatgatgctgctggatgcgcttatc
cagctaaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgattgatagccgtgataccgagactgacagccgcctcgacggtttgagtgatgca
ttcagcgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system