KEGG   Escherichia coli K-12 MG1655: b0794Help
Entry
b0794             CDS       T00007                                 

Gene name
ybhF
Definition
(RefSeq) putative ABC exporter ATP binding subunit
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0794 (ybhF)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    b0794 (ybhF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_23 AAA_22 AAA_30 Rad17 MukB AAA AAA_27 CLP1_P SRP54 AAA_24 AAA_16 AAA_33 cobW Thymidylate_kin KAP_NTPase
Motif
Other DBs
NCBI-GeneID: 945413
NCBI-ProteinID: NP_415315
Pasteur: ybhF
RegulonDB: ECK120003011
ECOCYC: G6411
ASAP: ABE-0002707
UniProt: P0A9U1
LinkDB All DBs
Position
complement(827245..828981)
Genome map
AA seq 578 aa AA seqDB search
MNDAVITLNGLEKRFPGMDKPAVAPLDCTIHAGYVTGLVGPDGAGKTTLMRMLAGLLKPD
SGSATVIGFDPIKNDGALHAVLGYMPQKFGLYEDLTVMENLNLYADLRSVTGEARKQTFA
RLLEFTSLGPFTGRLAGKLSGGMKQKLGLACTLVGEPKVLLLDEPGVGVDPISRRELWQM
VHELAGEGMLILWSTSYLDEAEQCRDVLLMNEGELLYQGEPKALTQTMAGRSFLMTSPHE
GNRKLLQRALKLPQVSDGMIQGKSVRLILKKEATPDDIRHADGMPEININETTPRFEDAF
IDLLGGAGTSESPLGAILHTVEGTPGETVIEAKELTKKFGDFAATDHVNFAVKRGEIFGL
LGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDLKESSGKARQHLGYMAQKFSLYGNLTVE
QNLRFFSGVYGLRGRAQNEKISRMSEAFGLKSIASHATDELPLGFKQRLALACSLMHEPD
ILFLDEPTSGVDPLTRREFWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLVYRGKLIAS
GTPDDLKAQSANDEQPDPTMEQAFIQLIHDWDKEHSNE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgccgttatcacgctgaacggcctggaaaaacgctttccgggcatggacaag
cccgccgtcgcgccgctcgattgtaccattcacgccggttatgtgacggggttggtgggg
ccggacggtgcaggtaaaaccacgctgatgcggatgttggcgggattactgaaacccgac
agcggcagtgccacggtgattggctttgatccgatcaaaaacgacggcgcgctgcacgcc
gtgctcggttatatgccgcagaaatttggtctgtatgaagatctcacggtgatggagaac
ctcaatctgtacgcggatttgcgcagcgtcaccggcgaggcacgtaagcaaacttttgct
cgcctgctggagtttacgtctcttgggccgtttaccggacgcctggcgggcaagctctcc
ggtgggatgaaacaaaaactcggtctggcctgtaccctggtgggcgaaccgaaagtgttg
ctgctcgatgaacccggcgtcggcgttgaccctatctcacggcgcgaactgtggcagatg
gtgcatgagctggcgggcgaagggatgttaatcctctggagtacctcgtatctcgacgaa
gccgagcagtgccgtgacgtgttactgatgaacgaaggcgagttgctgtatcagggagaa
ccaaaagccctgacacaaaccatggccggacgcagctttctgatgaccagtccacacgag
ggcaaccgcaaactgttgcaacgcgccttgaaactgccgcaggtcagcgacggcatgatt
caggggaaatcggtacgtctgatcctcaaaaaagaggccacaccagacgatattcgccat
gccgacgggatgccggaaatcaacatcaacgaaactacgccgcgttttgaagatgcgttt
attgatttgctgggcggtgccggaacctcggaatcgccgctgggcgcaatattacatacg
gtagaaggcacacccggcgagacggtgatcgaagcgaaagaactgaccaagaaatttggg
gattttgccgccaccgatcacgtcaactttgccgttaaacgtggggagatttttggtttg
ctggggccaaacggcgcgggtaaatcgaccacctttaagatgatgtgcggtttgctggtg
ccgacttccggccaggcgctggtgctggggatggatctgaaagagagttccggtaaagcg
cgccagcatctcggctatatggcgcaaaaattttcgctctacggtaacctgacggtcgaa
cagaatttacgctttttctctggtgtgtatggcttacgcggtcgggcgcagaacgaaaaa
atctcccgcatgagcgaggcgttcggcctgaaaagtatcgcctcccacgccaccgatgaa
ctgccattaggttttaaacagcggctggcgctggcctgttcgctgatgcatgaaccggac
attctgtttctcgacgaaccgacttccggcgttgaccccctcacccgccgtgaattttgg
ctgcacatcaacagcatggtagagaaaggcgtcacggtgatggtcaccacccactttatg
gatgaagcggaatattgcgaccgcatcggcctggtgtaccgcgggaaattaatcgccagc
ggcacgccggacgatttgaaagcacagtcggctaacgatgagcaacccgatcccaccatg
gagcaagcctttattcagttgatccacgactgggataaggagcatagcaatgagtaa

DBGET integrated database retrieval system