KEGG   Escherichia coli K-12 MG1655: b1654
Entry
b1654             CDS       T00007                                 

Symbol
grxD
Name
(RefSeq) glutaredoxin 4
  KO
K07390  monothiol glutaredoxin
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eco03110]
    b1654 (grxD)
   03029 Mitochondrial biogenesis [BR:eco03029]
    b1654 (grxD)
Chaperones and folding catalysts [BR:eco03110]
 Protein folding catalysts
  Protein disulfide isomerase
   b1654 (grxD)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    b1654 (grxD)
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-GeneID: 946169
NCBI-ProteinID: NP_416171
Pasteur: ydhD
RegulonDB: ECK120002074
ECOCYC: EG12181
ASAP: ABE-0005527
UniProt: P0AC69
Structure
LinkDB
Position
complement(1733754..1734101)
AA seq 115 aa
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRA
ELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagcaccactatcgaaaaaatccaacgccagattgctgaaaacccgatcctgctgtac
atgaaaggttcaccgaaactgccgagctgcggtttctctgcccaggcagtccaggcgctt
gccgcatgtggcgaacgttttgcctatgttgatattctgcagaatccggacattcgtgcg
gaactgccgaaatatgctaactggccgaccttcccgcaactgtgggttgacggcgagctg
gtcggcggttgtgatatcgtgatcgaaatgtatcagcgtggcgaactgcagcagctgatc
aaagaaactgccgctaaatacaagtctgaagagccggacgcggaataa

DBGET integrated database retrieval system