KEGG   Escherichia coli K-12 MG1655: b1900Help
Entry
b1900             CDS       T00007                                 

Gene name
araG
Definition
(RefSeq) arabinose ABC transporter ATP binding subunit
  KO
K10539  L-arabinose transport system ATP-binding protein [EC:7.5.2.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1900 (araG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1900 (araG)
Enzymes [BR:eco01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.12  ABC-type L-arabinose transporter
     b1900 (araG)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   L-Arabinose transporter
    b1900 (araG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N MMR_HSR1 AAA_29 AAA_23 AAA_25 AAA_15 AAA_30 cobW
Motif
Other DBs
NCBI-GeneID: 946408
NCBI-ProteinID: NP_416413
Pasteur: araG
RegulonDB: ECK120000054
ECOCYC: EG10058
ASAP: ABE-0006328
UniProt: P0AAF3
LinkDB All DBs
Position
complement(1983555..1985069)
Genome map
AA seq 504 aa AA seqDB search
MQQSTPYLSFRGIGKTFPGVKALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPT
TGSVVINGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLL
NYEAGLQLKHLGMDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREID
NLFRVIRELRKEGRVILYVSHRMEEIFALSDAITVFKDGRYVKTFTDMQQVDHDALVQAM
VGRDIGDIYGWQPRSYGEERLRLDAVKAPGVRTPISLAVRSGEIVGLFGLVGAGRSELMK
GMFGGTQITAGQVYIDQQPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRDNINISAR
RKHVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKV
ILLDEPTRGIDVGAKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMREGEIAGE
LLHEQADERQALSLAMPKVSQAVA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagtctaccccgtatctctcatttcgcggcatcggtaaaacgtttcccggcgtt
aaggcgctgacggatattagttttgactgctatgccggtcaggttcatgcgttgatgggt
gaaaatggcgcaggaaaatcaactctcttaaaaatcctcagcggcaactatgcgccaacc
acgggttctgtagtgattaatgggcaggaaatgtccttttccgacacgaccgcagcactt
aacgcgggcgtggcgattatttaccaggaactgcatctcgtgccggaaatgaccgtcgcg
gaaaacatctatctcggccagctgccgcataaaggcggcattgtgaatcgctcattgctg
aattatgaggcgggtttacaacttaaacatcttggtatggatattgacccggacacgccg
ctgaaatatctctccattggtcagtggcagatggttgaaatcgccaaagcgctggcgcgt
aacgccaaaattatcgcctttgatgagccaaccagctccctctctgcccgtgaaatcgac
aatcttttccgcgttattcgtgaactgcgaaaagaggggcgggtaatcttatacgtttct
caccgtatggaagaaatatttgccctcagcgatgccattactgtctttaaagatggacgt
tatgtcaaaacctttaccgatatgcagcaggttgaccacgacgcgctggtgcaggcgatg
gtcgggcgcgacattggcgatatctacggctggcaaccgcgtagttatggcgaggagcgc
ctacgtcttgatgctgtgaaagcaccaggcgtgcgtacgccaataagtctggcggttcgc
agtggtgaaattgttgggctgtttggtctggtaggggcggggcgtagcgaattaatgaaa
ggcatgtttggcgggacgcaaatcaccgccggtcaggtttatatcgaccaacagccgatc
gatattcgtaaaccgagccacgccattgccgcaggcatgatgctctgcccggaagatcgc
aaagcggaaggcattattcccgtgcactccgttcgcgacaatatcaacatcagtgccaga
cgtaaacatgtgctcggcggttgtgtaatcaacaacggttgggaagaaaacaatgccgat
caccacattcgttcgctcaacatcaaaacgccgggcgcggagcaactgatcatgaatctc
tcaggcggaaatcagcaaaaagccattctgggccgctggttatcggaagagatgaaggtc
attttgctggatgaacctacgcgcggcattgatgttggcgctaagcacgaaatatataac
gtaatttatgcgctggcggcgcagggcgtggcggtgctgtttgcctccagcgacttacct
gaagtcctcggcgttgccgaccggattgtggtgatgcgggaaggtgaaatcgccggtgaa
ttgttacacgagcaggcagatgagcgtcaggcactgagccttgcgatgcctaaagtcagc
caggctgttgcctga

DBGET integrated database retrieval system